2JDJ


Conserved Protein Domain Family
HapK

?
pfam11639: HapK 
Click on image for an interactive view with Cn3D
REDY-like protein HapK
This family of proteins represents HapK, a protein of unknown function, with two homologs PigK and RedY. The monomer structure of the protein contains a four-stranded anti parallel beta-sheet, three alpha-helices and a short C terminal tail which it uses for dimer formation. The surface of HapK has a deep cavity with consists of a kinked helix and a beta-four strand. HapK could be involved in prodigiosin biosynthesis, specifically the binding of a bipyrrole intermediate such as HBM or MBM.
Statistics
?
PSSM-Id: 402987
View PSSM: pfam11639
Aligned: 2 rows
Threshold Bit Score: 185.978
Threshold Setting Gi: 158428962
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2JDJ_B   2 ETIIHKIRLFDVAQADAFEFWVQNVDYATCPDLPSVVRFDVHRASLQANAPYHYVEVIKITDRAAFDADXETSTFAGLVQ 81  Hahella chejuensis
O54144   2 DVIIHRIRLHDGVDPARFEAWVRDVDYATCPRLPSVRAFAVHRVSTEQDAPFHYFESISVTGPDEFSRDMKTEAFRDLVT 81  Streptomyces coelicolor
2JDJ_B  82 AFSRXAEVVEELAGEQLGSGYAA 104 Hahella chejuensis
O54144  82 VFDTMATVVEEMSGELLEPGYQA 104 Streptomyces coelicolor
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap