4OH9,5XCV,6BN1


Conserved Protein Domain Family
Mst1_SARAH

?
pfam11629: Mst1_SARAH 
C terminal SARAH domain of Mst1
This family of proteins represents the C terminal SARAH domain of Mst1. SARAH controls apoptosis and cell cycle arrest via the Ras, RASSF, MST pathway. The Mst1 SARAH domain interacts with Rassf1 and Rassf5 by forming a heterodimer which mediates the apoptosis process.
Statistics
?
PSSM-Id: 402983
View PSSM: pfam11629
Aligned: 26 rows
Threshold Bit Score: 63.03
Threshold Setting Gi: 229274238
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4OH9_A                4 FDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDAMDAK 51  human
WGS:AAPU:GI20569-PA 611 FEFLKFLTYDDLNQRLSNIDHEMELEIEQLNKKYNAKRQPIVDAMNAK 658 Drosophila mojavensis
4_pfamImport          1 FDKLKFLSFDELKEKLSLIDREMERDIEELTNKYNSKRKPILDAITAK 48 
Q175W2              538 YDSLKFLNYEQLEQRLASIDKEMEKELAETNKRYHAKRKPIIDAIEAK 585 yellow fever mosquito
OWR44210            485 FEFLSFLSSSELEARMAALDAEMEAEIERLHQRYERKRRPILDAITLK 532 Danaus plexippus plexippus
EEN45075            434 FEFLKNLSSDELRRRFETLDQEMEREIEELRRRYQAKRQPILNAMDAK 481 Florida lancelet
A8XJW8              443 FEFLRNITLDELIRRKESLDSEMEEEIRELQRRYKTKRQPILDVIEIK 490 Caenorhabditis briggsae
XP_015784237        498 FEFLRYLPLDELRKRMANLDYEMENEIEELRRRYAAKRQPILDAIDTK 545 two-spotted spider mite
6BN1_A                3 FEFLKFLTFDDLNQRLCNIDHEMELEIEQLNKKYNAKRQPIVDAMNAK 50 
XP_028027806        438 fefLWQLSEAELEQRVARLDAQMEQEIELLRARYARKRQPILDAVTLK 485 wild silkworm
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap