6JXR


Conserved Protein Domain Family
TCR_zetazeta

?
pfam11628: TCR_zetazeta 
T-cell surface glycoprotein CD3 zeta chain
The incorporation of the zetazeta signalling module requires one basic TCR alpha and two zetazeta aspartic acid TM residues. The structure of the zetazeta(TM) dimer consists of a left-handed coiled coil with polar contacts. Two aspartic acids are critical for zetazeta dimerization and assembly with TCR.
Statistics
?
PSSM-Id: 402982
View PSSM: pfam11628
Aligned: 13 rows
Threshold Bit Score: 50.7481
Threshold Setting Gi: 82272182
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6JXR_AA       28 DPKLCYLLDGILFIYGVILTALFLRVKFSRS 58 
XP_005457870  27 EPVICYFLDGFLILYCIIVTGFFFREKFSKG 57  Nile tilapia
CAF95788      12 DPRVCYILDIFLGVYGLVITGMFIREKFFRS 42  spotted green pufferfish
AXN69661      27 DPQLCYILDGFLGIYGLIITGMFIKEKFFKS 57  Nile tilapia
XP_002936278  28 DPRLCYILDGLLFIYAIIVTALFFREKLSKv 58  tropical clawed frog
XP_003219175  28 DPRLCYILDGILLIYAIVITACFVKTKLSKG 58  green anole
XP_019475521  16 DPRLCYLLDGFLFIYAVIITALFVKAKLSQS 46  turkey
BAD93280       8 DPKLCYLLDGILFIYGVIITALFLREKFSRS 38  pig
XP_015219528  27 DPRLCYILDGVLLIYGIIITALYFKDKFSKP 57  spotted gar
XP_014352588  29 DPRLCYILDGILFIYGIVITALYLKNKLSAp 59  coelacanth
Q4T375        12 DANVCYILDGILVMFGAILTILFCRLKMNDA 42  spotted green pufferfish
NP_001003171  21 EPQLCYILDAILFLYGIVLTLLYCRLKIQVR 51  dog
NP_001093577  25 DPTYCYILDVILLVYSIIFTALYFREKFLKE 55  zebrafish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap