6A7K


Conserved Protein Domain Family
NdhS

?
pfam11623: NdhS 
Click on image for an interactive view with Cn3D
NAD(P)H dehydrogenase subunit S
This family is found in Bacteria and Streptophyta includes members such as NdhS (NAD(P)H-quinone oxidoreductase subunit S). NdhS, also known as CRR31 (chlororespiratory reduction 31), is a subunit of the chloroplast NADH dehydrogenase-like (NDH) complex. It is also a subunit of the cyanobacterial NDH-1 complex. NAD(P)H-oxidizing subunits have not been found in chloroplasts or cyanobacteria, where ferredoxin is probably the electron donor. NdhS contributes to the formation of a ferredoxin binding site of NDH and is necessary for high affinity binding of ferredoxin. The cyanobacterial NDH-1 complex, also known as NADPH:plastoquinone oxidoreductase or type I NAD(P)H dehydrogenase, is involved in plastoquinone reduction and cyclic electron transfer (CET) around photosystem I. The chloroplast NDH is more similar to cyanobacterial NDH-1, which is believed to be the origin of chloroplast NDH, than to mitochondrial NADH dehydrogenase present in the same species. The NDH complexes of chloroplasts, however, contain many subunits that are absent from cyanobacterial NDH-1 complexes.
Statistics
?
PSSM-Id: 402977
View PSSM: pfam11623
Aligned: 24 rows
Threshold Bit Score: 88.8636
Threshold Setting Gi: 81710562
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6A7K_A              9 ILPGMTVKVTNPNDTYYQFQGIVQRITDGKVAVLFEGGNWDKLVTFQASELE 60  Thermosynechococcus elongatus BP-1
XP_002973360      166 LMPGMTVIVKNPKNPYYMYTGILQRVTDGRAGILLEGGCWDKMLAIELKDLE 217 Selaginella moellendorffii
Q116P9              2 ILPGVAVKVKNLGDTYYGFQGQVQRVSDGKAAVLFEGGNWDKLVTFKLSELE 53  Trichodesmium erythraeum IMS101
jgi:Syn7502_01048   5 IFPGSAVRVSNVADTYYGFEGQVQRVSDGRVAVLFEGGNWDKLVSFRPTELE 56  Synechococcus sp. PCC 7502
jgi:Pse7367_0399    9 IFPGSAVKVSNQGDTYYGFEGVVQRFSDGRVAVVFSGGNWEKIVAFRPDELT 60  Pseudanabaena sp. PCC 7367
Q7NL85              5 LRPGMPVKVINPRDLYYGFEGQIQKVVDGYVGVIFGGATWIKHVRFVPSDLT 56  Gloeobacter violaceus
ASGPB:GKIL_1352     5 LRPGMPVKVVNSKDLYYGFEGQVQKVVDGFVGVIFAGGNWLKHVRFRPSDLE 56  Gloeobacter kilaueensis JS1
tgen:AM1_1451       2 ILPGSSVRVVNTGDTYFGFEGQVQRVADGQAAVIFDGGNWTKIVTFRLPELE 53  Acaryochloris marina MBIC11017
WP_015175937        2 IFPGSAVRVKDKGEIYYAFQGQVQRVSDGKVAVLFEGGNWDKLITFRLSQLE 53  Oscillatoria nigro-viridis
AHJ27649            2 ILPGSTVRVKNPADTYYRYEGLVQRVSDGKVAVLFEGGNWDKLITFRLSELE 53  Nodularia spumigena CCY9414
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap