2JWY


Conserved Protein Domain Family
DUF3251

?
pfam11622: DUF3251 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF3251)
This family of proteins with unknown function appears to be restricted to Enterobacteriaceae. Some members if this family are annotated as putative lipoprotein YajI however this cannot be confirmed.
Statistics
?
PSSM-Id: 402976
View PSSM: pfam11622
Aligned: 5 rows
Threshold Bit Score: 222.416
Threshold Setting Gi: 81645880
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2JWY_A          2 VQQSEVRQMKHSVSTLNQEMTQLNQETVKITQQnrlnAKSSSGVYLLPGAKTPARLESQIGTLRMSLVNITPDADGTTLT 81  Escherichia co...
jgi:Swit_3613   7 CMLMLLPALTACGSKTEERLKTIEARLAKVEQA----ADAHKAITLKPGGSGYSMIDGDMGRIAVAIANIEPYASGSRVV 82  Sphingomonas w...
Q6D851         21 AEQRQMPKLQNQIGQLNQQLQTLTDQATALERQnalnAQSASGVYLLPAAQTSTMLESSIGRLSVSLRNIETEANGTSAL 100 Pectobacterium...
WP_002890414   21 AQQSEIRQMHQSVSTLSQEMTQLNQQTIKITQQnalnAKSTRGVYLLPEAKTPARLESQIGTLRMSVGSITPDGDGSRLT 100 Enterobacteria...
Q8ZRD6         21 APQSEVRQMHQSISTLNKEMTQLNQETVKITQQnklnAESTRGVYLLPGANTPARLESQIGTLRMTLLEITPVADGAHAT 100 Salmonella ent...
2JWY_A         82 LRIQGESNDPLPAFSGTVEYGQIQGTIDNFQEINVQNQLINAPASVLAPSDVDIPLQLKGISVDQLGFVRIHDIQP 157 Escherichia coli K-12
jgi:Swit_3613  83 LDFGNPTAARLSGLKAKIEWGSNDAKGLPMAATSTQSLLFTAPEPLPPGSWKQYTVDLAGVPPTQLGWVRVSGFDN 158 Sphingomonas witti...
Q6D851        101 LHIRTLDAKGLPAFGAQLDWGRLDPVSGKPLAGDTQTQSFVVSPTLLPKTEAIIELRLSSLSPEELGFVRVHQVQE 176 Pectobacterium atr...
WP_002890414  101 LRIQGESNDPLPAFTATVASGQITGTTHSYQEVNVQDQLISAPASTLAPSDVDIPLRLN-VTPDKVGFIRVHDIQP 175 Enterobacteriaceae
Q8ZRD6        101 LHIQGESRDPLPAFSATVEYGQLQGTTENYQEVNAQSLLVNAPASLLAPSDVNISLPLKGITPAQLGFIRIHDIQP 176 Salmonella enteric...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap