Conserved Protein Domain Family
COMP

?
pfam11598: COMP 
Cartilage oligomeric matrix protein
This family of proteins represents the five-stranded coiled-coil domain of cartilage oligomeric matrix protein (COMP). This region has a binding site between two internal rings formed by Leu37 and Thr40
Statistics
?
PSSM-Id: 402957
View PSSM: pfam11598
Aligned: 9 rows
Threshold Bit Score: 45.0985
Threshold Setting Gi: 122094332
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
NP_001121589  233 VSELIVQLSDLTSVLQDIHHEMKEQILEARALRTTIQQCTLCK 275  vase tunicate
Q7QK54        223 DENILKLLGELMKLVKELKEEVKGQRHEINYLRGLIENCAGCQ 265  Anopheles gambiae str. PEST
Q16ZU9        251 DENLARSLNELIQMVRELREEVRRQREEIQQLRSLIENCAGCQ 293  yellow fever mosquito
Q9VM97        245 EDALARSLSDLLALVKLLREDVAHQRQEIAYLRMLLENCAGCK 287  fruit fly
Q8JGW0        223 TKQLTTQMLELTKVINELKDVLIQQVKETSFLRNTISECQACG 265  zebrafish
P35443        220 NRQFLGQMTQLNQLLGEVKDLLRQQVKETSFLRNTIAECQACG 262  human
Q08D10        218 SRQLIGQITQMNQLLGELRDVMRQQVKETMFLRNTISECQACG 260  tropical clawed frog
NP_001121588  236 ATVLAAQLLQFTRMMTSLKTDMRHMAHETALLRQTIIRCHACG 278  vase tunicate
P49746        228 TKALVTQLTLFNQILVELRDDIRDQVKEMSLIRNTIMECQVCG 270  human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap