5EOF


Conserved Protein Domain Family
NEMO

?
pfam11577: NEMO 
Click on image for an interactive view with Cn3D
NF-kappa-B essential modulator NEMO
NEMO is a regulatory protein which is part of the IKK complex along with the catalytic IKKalpha and beta kinases. The IKK complex phosphorylates IkappaB targeting it for degradation which results in the release of NF-kappaB which initiates the inflammatory response, cell proliferation or cell differentiation. NEMO activates the IKK complex's activity by associating with the unphosphorylated IKK kinase C termini.The core domain of NEMO is a dimer which binds to two fragments of IKK.
Statistics
?
PSSM-Id: 371612
View PSSM: pfam11577
Aligned: 7 rows
Threshold Bit Score: 63.6549
Threshold Setting Gi: 170285285
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5EOF_A        16 PEELLQQMKELLTENHQLKEAMKLNNQAMKGRFEELSAWTEKQKEERQFFEIQSKEAKERLMALSHE 82 
Q90Z16        37 PEEMVQQMKELITENNELKEAMKLHNQAMKDRYEELSIWREKQKEEREFYETKFKEAKQCLLAKCVE 103 chicken
Q8VC91        44 EQGTPETLQRCLEENQELRDAIRQSNQMLRERCEELLHFQVSQREEKEFLMCKFQEARKLVERLSLE 110 house mouse
XP_005162127  43 dLAGNEIVQKLITDNHQLREALKRSNDALKERCEEMEGWQRRSREEREFLSCRFREARELVQRLAQE 109 zebrafish
Q3ZC32        37 PHELLQQMRELLIENHQLKEAMKLNNQAMKGRFEELSAWTEKQKEERLYFETQSKEAKERLTALSLE 103 cattle
AAI61287      31 DAEMLEQIKQLLMENNNLKETMKQMNQEMKERLEELLKRHNQHLLDLNSENELLRKELNSLREKNAT 97  tropical clawed frog
AAH55628      19 LEETLQQMNTLIKENRDLKEALKQTNLSMKERFEGLSAWKEKQKEERDFLEQRLEEARTRLNTMDVE 85  zebrafish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap