2KJ3


Conserved Protein Domain Family
HET-s_218-289

?
pfam11558: HET-s_218-289 
Click on image for an interactive view with Cn3D
Het-s 218-289
This family of proteins is residues 218-289 of Het-s, a protein of Podospora anserina. Het-s plays a role in heterokaryon incompatibility which prevents different forms of parasitism. This region of the protein is the C-terminal end and is unstructured in solution but forms infectious fibrils in vitro which has a structure consisting of a left-handed beta solenoid which contains two windings per molecule.
Statistics
?
PSSM-Id: 402935
View PSSM: pfam11558
Aligned: 16 rows
Threshold Bit Score: 83.5214
Threshold Setting Gi: 297342833
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2KJ3_A         6 IVGRNSAKDIRTEERARVQLGNVVTAAALHGGIRISDQTTNSVETVVGKGESRVLIGNEYG 66 
EMT74562     222 IAGRNYAKDINSEGMARVRIGNEWSETAFTRGTGIADRTVNLADSVAAKGTSAVHIGNQYG 282 Fusarium oxysporum f. sp. cubense ...
EGU74155     222 IAVRIYAKDIKSEEMARVRVGNEWSEAALGRGTAIADQTVSRVDSVAARGKSAVHIGHQYG 282 Fusarium oxysporum Fo5176
EEU42351     223 VEVQNFAARVKTSESGKFEIGNIFTKEASGQSVGFPYRNTNRVEDIEVKGDSGVHVGDTYG 283 [Nectria] haematococca mpVI 77-13-4
EMT72093     223 IAGKNSAGRITGPGRVKI--GNSFLTESFPNSQRVRVDTVNHVDEINTAEPSRVHIGNTWG 281 Fusarium oxysporum f. sp. cubense ...
EMT70475     223 ITGKNSAGRISGSGAVNI--GNTFVKESFLQSKGFKDHTTNYVNEVDTAETGRVNIGNTYG 281 Fusarium oxysporum f. sp. cubense ...
EMT74561     218 IAVRNYASEIKGDEDAKVRLGNDWSANALSAAIGLEDRTHNEADSVTAKGSSTVHIGNIYG 278 Fusarium oxysporum f. sp. cubense ...
EEU47148     224 ISVRNSVKVINSSEDANVRLGNDWSTAALNAA--IEDRTRNEADSVFAEGSSVVHIGNRYG 282 [Nectria] haematococca mpVI 77-13-4
EEU38121     217 ISVRNYVREIQGEENAKVRLGNDWSTSALSTAIGLDDRTRNEAGSVTAKGSSTVHIGNRYG 277 [Nectria] haematococca mpVI 77-13-4
XP_003045343 180 TATRNEPGKTLVEEMERIRVGNEWSESVLNQGALVMDRTENKALAITARGGATIHIGSSFG 240 [Nectria] haematococca mpVI 77-13-4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap