Conserved Protein Domain Family
Omp_AT

?
pfam11557: Omp_AT 
Solitary outer membrane autotransporter beta-barrel domain
Omp_AT is a family of Gram-negative Gamma-proteobacteria outer membrane autotransporter beta-barrel proteins. Secondary structure prediction indicates a beta-barrel domain of 12 beta-strands. with an N terminal helix running along the central barrel axis perpendicular to the 12 antiparallel strands that form the barrel. Autotransporter translocation units defined by a beta-barrel of 12 to 14 antiparallel strands with an N terminal helix perpendicular to the barrel.
Statistics
?
PSSM-Id: 371601
View PSSM: pfam11557
Aligned: 6 rows
Threshold Bit Score: 471.552
Threshold Setting Gi: 126639996
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Shew_3773   1 MISLSFSRLkhvaaqglaaLGLTLLLGSGtTvlAQEIDirGAVEAKVKGDITSAMVLTDANLITLGIVDFNPNTIVDLse 80  Shewanella loi...
Q5E068          1 MIRLRPSLL----------VMILLYLAYD-K--AEARN--LTPASQFEEAFATSLVLSDSNMITFGIADFNPNRYLSK-- 63  Aliivibrio fis...
Q47YY7          1 MLTKPKIHF----------KTLVFLISSLlShhSIANN-----KTHFEELFSTSVVLTDSETITLGIGNFDPDKLLKP-- 63  Colwellia psyc...
WP_020912860   12 QLSL---------------LVCSLVFTADcS--SQTFD--SFVGRITKENIATSIVLTDANLISLGVISFDPSSVIDF-- 70  Shewanella pie...
Q9KM30          1 MMKLPLRLS----------FGCLLVMSFSaT--AKSYD---FIQEHLEQAFSSSVVLSDSDVFTAGFNNFDPNDWFKT-- 63  Vibrio cholerae
Q7ME68          1 MLRFPFAVSts-------vFAIILLPSFAlS--AQELN--DLIQKELERNFATAIVLTDSDVFTVGFHDFDPNEWLNL-- 67  Vibrio vulnifi...
jgi:Shew_3773  81 iGDIN----AGDEESLKRRSQLTSYTLPWesdTVPLSPE----------------WSQSIQVRLSYVHASDSIQGLEDeT 140 Shewanella loi...
Q5E068         64 -DENNpdngLGSNDSIQLRNQMTVYSLPY---TFELTEDpd------------srWSHEITVRASYVNTDIDVEFKDK-T 126 Aliivibrio fis...
Q47YY7         64 -HEQS----FSESDSIKLRNELTVYSIPY---TWRLTDDksktkdkakkeksnffYLDELTASLSYLKQENKNDLLSNsS 135 Colwellia psyc...
WP_020912860   71 -GDIN----TGSQDSLQRRRELKTYSLPWksdWRDFTDN----------------WQTSTYVKLSYVSSEQTIDYSQPtK 129 Shewanella pie...
Q9KM30         64 -DNDN----LGTPESIENRKKYKSSTLPI---TLALSEEea-------------yHQHQLFFRLSASVIDDELSIANMpG 122 Vibrio cholerae
Q7ME68         68 -DNEE----LGSADSVNLRKKIGVSTLPF---EFALYEDpd------------sqIKHSLQGRLSALGIEQDVSIVDT-S 126 Vibrio vulnifi...
jgi:Shew_3773 141 ISSPIKDTSYLLAGEYRWKYQINEQWRAVFGLGAQFIWLENRLIYNDPVLRSVSGILDDKLVNTSYGAIMFDPNAELTYT 220 Shewanella loi...
Q5E068        127 SPDSDLDEMFGLYAEYAQNYDFYENWTISVGNAFHLMHYRNTHTYNSDFSQSFAPVLDGLYYNVSSNAFIIEPKITFQYK 206 Aliivibrio fis...
Q47YY7        136 ITDDNKDEVFSAYLAYSRHRQLTENWNLRVRFGSYLMHHKNKYRYNSDESKQYQDQLDGVFLNLSANAFIIEPNVKLSYS 215 Colwellia psyc...
WP_020912860  130 DFDSYEEKSYLTQAEQRWQRQLSEHWKVQLGVGGQLIWYENSFQYSS-VLAQLKPIFDNRLVNTSYGALMLDPSIEFRYD 208 Shewanella pie...
Q9KM30        123 ETERYRQSVLGGAIFYRYQYRLTDHWTLTPAIGTHLLYYRNTVTYNNPQFKMLFSPLDGLLVNTYAWANLVETNLKIQYE 202 Vibrio cholerae
Q7ME68        127 VSDSHREYVLGAFLEYTNSRQLSENWTFDASIGAHLMYYRSDYTYRSDALADYKSVIDGYLVNTDAWALVAEPNVQAKYL 206 Vibrio vulnifi...
jgi:Shew_3773 221 GDLMGNKWEFISTLRYGIGRSL-LTDDGMQAVTPQVGRLSNALVFHYGLPDFFDRQNEMRLLAKRIDLSGDVIDPMGTRH 299 Shewanella loi...
Q5E068        207 KETDWGEWRFNNSYHYAYGQGFgGSSDYSSDANPEVWRFVNSIQLRYNMAHWNRLAQVLYLKAKRVDLGGDANEPLGTDF 286 Aliivibrio fis...
Q47YY7        216 QKKDWGKWEFNNDLNVFSGVTF-KGAKSSQDAKPTGWRLNNGFKFHFNVNQSKFHAESIYVKIQRSDIGGDMVSSLGTDH 294 Colwellia psyc...
WP_020912860  209 NLLWGHRWQFISSYRYAIGHTV-LTDSTMQEVSSQVGRFTNTFMLHYPLPQIAESNNELHLMFKRIDLSGDAVAPLETDN 287 Shewanella pie...
Q9KM30        203 EEKSWGRWKASSAWHYFGGYGW-GKANNGEVGNPEGWYIANTLTGVYDFTQLGRSVQSIYGSIKRVDVGSTPQEPLGTSN 281 Vibrio cholerae
Q7ME68        207 QMKPWGKWYYWSSAHYFYGQGW-GEANRGQVGNPEGWYWVNGVKMFYDFEKWGRAVQSVYTSFNRVDVGGDTSESLGTRH 285 Vibrio vulnifi...
jgi:Shew_3773 300 YYEFGAGWVVQTPSLSAWLRNIGIGITLNINSGLSGGGIVLLFNE 344 Shewanella loihica PV-4
Q5E068        287 YYEFNIAWLIDTRKWISLVDNVGIGFTFNVGSALRGGSIVLFYDE 331 Aliivibrio fischeri ES114
Q47YY7        295 FYEFGVGLLLDTRKFTKLADNIGIGINIHKGSALSGGSIVFYFNE 339 Colwellia psychrerythraea 34H
WP_020912860  288 YYQVGVGWVIDTPWLTSWVDNLGIGLTVNVGSVLSGGSILLLFNE 332 Shewanella piezotolerans
Q9KM30        282 YYEASFGWLMTPPFEMELVDNIGLGLTFNYGSAFKGGSIVLFFNQ 326 Vibrio cholerae
Q7ME68        286 YYEASVGWLMTPPFKTQWVDNVGIGLSLNYGSALKGGSLVLFFNQ 330 Vibrio vulnificus YJ016
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap