2QHO


Conserved Protein Domain Family
E3_UbLigase_EDD

?
pfam11547: E3_UbLigase_EDD 
E3 ubiquitin ligase EDD
EDD, the ER ubiquitin ligase from the HECT ligases, contains an N-terminal ubiquitin-associated domain which binds ubiquitin. Ubiquitin is recognized by helices alpha-1 and -3 in in the UBA domain. EDD is involved in DNA damage repair pathways and binds to mono-ubiquitinated proteins.
Statistics
?
PSSM-Id: 402926
View PSSM: pfam11547
Aligned: 7 rows
Threshold Bit Score: 79.8618
Threshold Setting Gi: 158430213
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2QHO_B          2 SIPASVIPEELISQAQVVLQGKSRSVIIRELQRTNLDVNLAVNNLLSRDDED 53  
Q80TP3        179 VIPASVIPEELISQAQVVLQGKSRSVIIRELQRTNLDVNLAVNNLLSRDDED 230  house mouse
XP_003112322  181 RVPATNVPEELINNVQQVLQGKSRDVIIRELQRTGLNVNEAVNNLLSRDDGD 232  Caenorhabditis remanei
XP_018673163  189 AILSAQVPEDLINQVQNVLQGKSRNVIIRELQRTSLDVNLAVNNLLSRDDED 240  vase tunicate
EDV23599      157 VLPVNLVPDDLIEQVQGVLQDKSRQVIIRELQRSNLDVNVAVNNLLSRDDDD 208  Trichoplax adhaerens
CDS35612      135 qISPADVPENLIEQCQMVLQGKSRQLIIRELQRTNLDVNMAVNNMLSREDEa 186  Echinococcus multilocularis
Q7PY72        144 SVPAPFVPEELVAQAQVVLQGKSRNLIIRELQRTNLDVNLAVNNLLSRDDEG 195  Anopheles gambiae str. PEST
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap