2PQN,2PQN


Conserved Protein Domain Family
Mdv1

?
pfam11542: Mdv1 
Click on image for an interactive view with Cn3D
Mitochondrial division protein 1
Mdv1 is a component of the mitochondrial fission machinery in Saccharomyces cerevisiae. The protein is also involved in peroxisome proliferation. Mdv1 along with Fis1 is also involved in controlling Dnm-1 dependant devision, a GTPase involved in the mediation of mitochondrial division. In this role, Mdv1 is the linker between Fis1 and Dnm1. Mdv1 plays a key role in the regulation of Dnm1 self-assembly.
Statistics
?
PSSM-Id: 402923
View PSSM: pfam11542
Aligned: 2 rows
Threshold Bit Score: 93.2962
Threshold Setting Gi: 160285785
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2PQN_B  6 ADGKLLTEGGENENLRKNASKKETSLFQGFKSYLPIAELAIENTERLNY 54  baker's yeast
2PQN_B  6 ADGKLLTEGGENENLRKNASKKETSLFQGFKSYLPIAELAIENTERLNY 54  baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap