Conserved Protein Domain Family
DUF3227

?
pfam11537: DUF3227 
Protein of unknown function (DUF3227)
This archaeal family of proteins has no known function.
Statistics
?
PSSM-Id: 371589
View PSSM: pfam11537
Aligned: 4 rows
Threshold Bit Score: 124.53
Threshold Setting Gi: 74502557
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015591358     6 SPRDLVITAVKNAIKKTDPTLLKILEVHLESREGKGLDMAYENPEKFVDSMRDLFGEYSGRFFELLLIQEVKelvgFKEQ 85  Archaeoglobus...
Q5JDP9           5 LNRALIVATAKELLSQFGPHFLPTLEAYLRAKYNATLEIAGEDPAKFYRAVEELFGEFGASMFFYNLLMELH----LKPD 80  Thermococcus ...
jgi:Arcpr_1364   4 NPEEVMIRAVRNATRRANPALEKILEIHLKMQANAGFELAYRDPKRFKELVNRLFGEYSGRLLEMLIVDEVKklleVEED 83  Archaeoglobus...
Q8U344           3 NGKDILTKTIISALKEVAPGLEAVLEAHLNATLNKGIEVAYEDPQKFKEAVSKLFGEYSARLLEMVIISKLQsylgKQVE 82  Pyrococcus fu...
WP_015591358    86 PNSLKEAIEILKT 98  Archaeoglobus sulfaticallidus
Q5JDP9          81 KRDKETVIALLKK 93  Thermococcus kodakarensis KOD1
jgi:Arcpr_1364  84 IDILEKAVEILRl 96  Archaeoglobus profundus DSM 5631
Q8U344          83 VNSLEELVEEIKK 95  Pyrococcus furiosus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap