2OYY


Conserved Protein Domain Family
HTHP

?
pfam11534: HTHP 
Click on image for an interactive view with Cn3D
Hexameric tyrosine-coordinated heme protein (HTHP)
HTHP is from the marine bacterium Silicibacter pomeroyi and has peroxidase and catalase activity. HTHP consists of six monomers which each binds a solvent accessible heme group and is stabilized by the interaction of three neighboring monomers. The heme iron is penta-coordinated with a tyrosine residue as proximal ligand.
Statistics
?
PSSM-Id: 402917
View PSSM: pfam11534
Aligned: 15 rows
Threshold Bit Score: 102.863
Threshold Setting Gi: 119376345
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2OYY_C           4 TWLP--TLVTATPQEGFDLAVKLSRIAVKKTQPDAQVRDTLRAVYEKDANALIAVSAVVATHFQTIAAANDYWK 75  Ruegeria pomeroyi
jgi:Dshi_0225   28 SWLP--SLLTETPAQGFDLAVTMARKGVTTTQGDKEVLFAVRPNYARDPQSLIDVSGVIAMYFATIAEANDHWE 99  Dinoroseobacter shi...
jgi:Pden_3026   35 TWLP--TLQVDTPQQGFDLAIVMARRAVRTTQPDVAMLKAQRSRYAEDAASLIDVSAVAAAWFATIAAANDYWR 106 Paracoccus denitrif...
Q1QQI0           4 TWLP--SLKTDTPQAGFELAVKLSRVGVKYTQPSDEVRSSLRSDYDHDTTQLIASSHVIAVHFQTVAAANNWWR 75  Nitrobacter hamburg...
zuci:PHZ_c2141   6 SWLP--TLKTDTPEAGYQLALKLSRMAVKLTQPSAEVRDELRTQYERDSGELIEIAHVVAVNFQTVAAANDYWR 77  Phenylobacterium zu...
CDM25308         4 TWLT--SLITATPQEGFELAIKLARMGVKYTQPSAEVRDKLRPVYGEDANALIASSQVVAINFQTIAAANGYWK 75  Castellaniella defr...
WP_012178974     3 SWLP--TLTTATPEEGYDLAVKLARVAIKLTQPDAEARDRMRPEYAEDADALIAVSQVVATHFATVAAANGYWR 74  Dinoroseobacter shibae
jgi:Aeqsu_2959   6 qLIPgnSLITETPEEGRLLAVKMARLNIKFTQPDAAVRERLRPIYAEDAAMLIAIGQVVAIEFATIAAANDYWN 79  Aequorivita sublith...
WP_004005886    24 qgiPggTLITETPEEGRQLAMLIARHTIHQIQPNPDALKAGRPEYAVDPDSLTAAAQVVAIEFQTIAAANNYWR 97  Rothia
jgi:Belba_3224   6 neLT--SLITSTPQEGRDLAVKLARKSIAEIQTDPEIRKSLRKSYAEDTAQLIASAQVVAVEFQTIAMANNYWR 77  Belliella baltica D...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap