2QVT


Conserved Protein Domain Family
AvrL567-A

?
pfam11529: AvrL567-A 
Click on image for an interactive view with Cn3D
Melampsora lini avirulence protein AvrL567-A
AvrL567-A is a protein from the fungal pathogen flax which induces plant disease resistance in flax plants. The protein has a novel fold.
Statistics
?
PSSM-Id: 151966
View PSSM: pfam11529
Aligned: 3 rows
Threshold Bit Score: 281.564
Threshold Setting Gi: 159795373
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2QVT_A  24 MEDVPAELTGVSEGYTRFYRSPTASVTLSGLVNVKWDNEQMTMPLFKWIGGEQAEELHFCVHIAHSIGPKLNLARTLGTV 103 flax rust
Q6R659  24 MEHVPAELTGVSEGYTRFYRSSTASVILSGLVKVKWDNEQMTMPLFKWIGGEQAEELHFDVHIAHSSGRRLDRARTLGAV 103 flax rust
Q1HBK1  24 MEDVPAELTGVSEGYTRFYRSPTATVTLSRLVDVKWDNEQMTMPLFKWTGGEQAEELHFCVHIAHSSGRRLNSARTLGTV 103 flax rust
2QVT_A 104 NSNMDQHWAQAHRHSGATRRTIQDFHLFANDIPNFPDYIKIKLVPKT 150 flax rust
Q6R659 104 NSNMDQHWVEAYRSSGVTRCTIQDCHLFENDIPNFPDYIKIKLVPKT 150 flax rust
Q1HBK1 104 NSNMDQHWVEAYRSSGVTRCTIQDCHLFANDIPDFPDYIKIKLVPKT 150 flax rust
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap