5WVW


Conserved Protein Domain Family
Cren7

?
pfam11520: Cren7 
Click on image for an interactive view with Cn3D
Chromatin protein Cren7
Cren7 is a chromatin protein found in Crenarchaeota and has a higher affinity for double-stranded DNA than for single-stranded DNA. The protein contains negative DNA supercoils and is associated with genomic DNA in vivo.Cren7 interacts with duplex DNA through a beta-sheet and a long flexible loop. The function has not been completely determined but it is thought that the protein may have a role similar to that of archaeal proteins in Euryarchaea.
Statistics
?
PSSM-Id: 402907
View PSSM: pfam11520
Aligned: 8 rows
Threshold Bit Score: 68.6686
Threshold Setting Gi: 74564364
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5WVW_B            5 KKPVKVKTP-AGKEAELVPEKVWAAAPKGRKGVKIGLFKDPETGKYFRHKLPDDYP 59  Saccharolobus solfataricus P2
A3DL40            5 KDAVKVKTL-SGKEVELVPKKVWQLSPKGRKGVKVGLFQDPETGKYFRAKVPDDYP 59  Staphylothermus marinus F1
jgi:Igag_1821     5 TKPVRVKTP-DGAEKELVPKKVWGLAPKGRKGVKIGLFQDPATGKYFRGKVPDDYP 59  Ignisphaera aggregans DSM 17230
CBRAS:FFONT_0793  3 KRPVKVKDRiTGKEYELVPIKVWKLSPNKKRGIKMGLFQNPETKIYFRARVPDDYP 58  Fervidicoccus fontis Kam940
WP_013129173      4 DKPVKVKTA-TGKELELIPKKVWQLNPRGKKGVKVGLFQDPETGTFFRAKVPEDYP 58  Thermosphaera aggregans
Q8ZX17            7 NREYEVEY--EGRKYFLRPVKAWVLQPPGKPGVVVALFKLP-NGKSIRKVIMRLPP 59  Pyrobaculum aerophilum str. IM2
WP_012607852      8 TEKVKVKTP-GGRELELVPVKVWQLNPRGRKGVKIGLFQDPGTGRYFRTRVPEEYP 62  Desulfurococcus amylolyticus
A2BL68            4 EKPVKVRDPtTGKEVELVPIKVWQLAPKGRKGVKIGLFKSPETGKYFRAKVPDDYP 59  Hyperthermus butylicus DSM 5456
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap