2JS3


Conserved Protein Domain Family
DUF3222

?
pfam11519: DUF3222 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF3222)
This family of proteins with unknown function appears to be restricted to Rhodopseudomonas.
Statistics
?
PSSM-Id: 402906
View PSSM: pfam11519
Aligned: 2 rows
Threshold Bit Score: 139.839
Threshold Setting Gi: 122476032
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2JS3_B 22 MTDTAAEDVRKIATALLKTAIEIVSEEDGGAHNQCKLCGASVPWLQTGDEIKHADDCPVVIAKQILsSRPKLHAV 96  Rhodopseudomonas palustris ...
Q213F4  1 MTAFAAEDVRKIALALSRTAIETVSEEDGGARNQCKLCHASVAWEHKGDDIVHQPDCAVAIGQRLL-AKLQPHGV 74  Rhodopseudomonas palustris ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap