Conserved Protein Domain Family
Atu4866

?
pfam11512: Atu4866 
Agrobacterium tumefaciens protein Atu4866
Atu4866 is a protein with unknown function from Agrobacterium tumefaciens however the structure has been determined. Atu4866 adopts a streptavidin-like fold and has a beta-barrel/sandwich which is formed by eight antiparallel beta-strands. Atu4866 has a potential ligand-binding site where is has a stretch of conserved residues on the surface.
Statistics
?
PSSM-Id: 371572
View PSSM: pfam11512
Aligned: 20 rows
Threshold Bit Score: 116.296
Threshold Setting Gi: 269096921
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2KDH4              57 HPYVGMWVTEDGRVRHELLPDNRYDEARGNREHAYRGRYEVTGTHIEYRDDTGFIADGDFVDDnTLHHGGMVLRR 131 Rhizobium etli...
jgi:Mmwyl1_0902     10 QSYSGMWMTADGYIRHELLPNNRYVEARGNIESAYEGRYRITGDDIEYWDDTGFTADGTFIDG-VLYHAGMILYR 83  Marinomonas sp...
QianUST:TMO_c0207   30 HPYIGMWVTEDGRIRHELRADGRYVEARGSREAAYQGRYTITGDHIDYVDDTGFTADGDFVDG-VLYHAGMILYR 103 Tistrella mobi...
Q2IEG9               4 NKYVGMWVTADGYVRHELLPNGRYDEARGDRKSAYQGRYTLTGDHIDYVDDTGFTADGDFMNG-VLHHAGMVLCR 77  Anaeromyxobact...
XP_006683181        10 YSYVGMWMTKDRYIRHELLPNGRYDEARGNRKSAYQGSYTITSNYIEYIDDTGFTADGNFQNG-ILYHAGMILYR 83  Batrachochytri...
sklacau:PSAB_05505  27 HPYLGMWVTKDGYIRHELLPNGRYDEARGNRKSAYQGRYTIAGDHIEYVDDTGFAADGDFRDG-ILYHAGMILYR 100 Paenibacillus ...
WP_009151872       169 QSRVGVWVDTDGFLHQELTADGRYDETRGGRPHAFQGSYWVDGNRIDYLDDLGFWAFGQFVGD-TLHHAGYTMHR 242 Saccharomonosp...
WP_015655389       177 sPRVGVWIDRKDFLHQELIADGRYDETRGGRPHAYQGRYWIDGDRIDYLDDLGFWAYGEFQGD-ELHHAGYVMkl 250 Streptomyces d...
jgi:Ndas_0453      167 SPYLGMWIDETGFIHQELTADGRYDETRGGRPHAYQGSFWIEGDRIVYRDDLGFWAYGRFADD-VLHHAGYVFHR 240 Nocardiopsis d...
jgi:Sked_14200      31 pDWVGAWTDPSRGMTQHLSADGRYSETRGGRRDAYTGCFWAHRDWVAYLDDTGFWAFGQRADD-VLHHARFVLRR 104 Sanguibacter k...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap