5T3W,5T3T


Conserved Protein Domain Family
Transcript_VP30

?
pfam11507: Transcript_VP30 
Click on image for an interactive view with Cn3D
Ebola virus-specific transcription factor VP30
VP30 is a nucleocapsid-associated Ebola virus-specific transcription factor. It acts by stabilizing nascent mRNA in Ebola virus replication. The C terminal domain of VP30 folds into a dimeric helical assembly. VP30 assembles into hexamers in solution by an N-terminal oligomerization domain which activates the transcription function of the protein. The oligomerization is mediated by hydrophobic amino acids at 94-112.
Statistics
?
PSSM-Id: 402900
View PSSM: pfam11507
Aligned: 2 rows
Threshold Bit Score: 239.938
Threshold Setting Gi: 1070701224
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5T3W_E  47 LTLENLGHILSYLHRSEIGKLDETSLRAALSLTCAGIRKTNRSLINTMTELHMNHENLPQDQNGVIKQTYTGIHLDKGGQ 126 Marburg virus - Musok...
5T3T_A  47 ITLLTLIKTAEHWARQDIRTIEDSKLRALLTLCAVMTRKFSKSQLSLLCETHLRREGLGQDQAEPVLEVYQRLHSDKGGS 126 Ebola virus - Mayinga...
5T3W_E 127 FEAALWQGWDKRSISLFVQAALYVMNNIPCESSiSVQASYDHFILPQSQGK 177 Marburg virus - Musoke, Kenya, 1980
5T3T_A 127 FEAALWQQWDRQSLIMFITAFLNIALQLPCESS-AVVVSGLRTLVPQSDNE 176 Ebola virus - Mayinga, Zaire, 1976
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap