2HQL


Conserved Protein Domain Family
DUF3217

?
pfam11506: DUF3217 
Protein of unknown function (DUF3217)
This family of proteins with unknown function appears to be restricted to Mycoplasma. Some members in this family of proteins are annotated as MG376 however this cannot be confirmed.
Statistics
?
PSSM-Id: 402899
View PSSM: pfam11506
Aligned: 4 rows
Threshold Bit Score: 152.439
Threshold Setting Gi: 81420964
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2HQL_A   7 MLNRVFLEGEIESSCWSVKKTGFLVTIKQMRFFGERLFTDYYVIYANGQLAYELEKHTKKYKTISIEGILRTYLERKSEI 86 
Q7NBT6   2 MLNTVLLEGLIDSYKWSKNKTGFYVTITQKRKFGNQTFTDYYVIYANDQLGLELEKYVLEHEYLAVKGSLTTYQDKKSKV 81  Mycoplasma gallisepticum
P75224   1 MLNRVFLEGEIESSCWSVKKTGFLVTIKQMRFFGERLFTDYYVIYANGQLAYELEKHTKKYKTISIEGILRTYLERKSEI 80  Mycoplasma pneumoniae...
P47616   1 MLNCVFLEGEIESTKWSHKKTGFLVTIKQKRLFGERSFTDFFVFYANGQLAFELEAYTQKFKTISIEGILRTYLEKRSGI 80  Mycoplasma genitalium...
2HQL_A  87 WKTTIEIVKIFNpkneividykEI 110
Q7NBT6  82 WKTQILAEKILV----------RK 95  Mycoplasma gallisepticum
P75224  81 WKTTIEIVKIFNpkneividykEI 104 Mycoplasma pneumoniae M129
P47616  81 WKTTIEVVKIMKpnskvmidyqES 104 Mycoplasma genitalium G37
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap