2HJM


Conserved Protein Domain Family
DUF3216

?
pfam11505: DUF3216 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF3216)
This family of archaeal proteins with unknown function appears to be restricted ton Thermococcaceae.
Statistics
?
PSSM-Id: 402898
View PSSM: pfam11505
Aligned: 2 rows
Threshold Bit Score: 115.823
Threshold Setting Gi: 151567599
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2HJM_A  10 VEKVKELCLELEEENLAKAIERFITLTHGIEKTRGEAFAKASIYGFLEGILTTLKXKYSNEKIETLLNEVKTAREETEAL 89  Pyrococcus furiosus
Q5JG14   7 VEELKALLNELGEEGLLERLDAFVRMNGGLESKRGEDFIKVSILGFAEGLLTVLKEKYDEPRVKELYEKIKAKRAELDEQ 86  Thermococcus kodakare...
2HJM_A  90 LRKPRPPLLVD 100 Pyrococcus furiosus
Q5JG14  87 FRKPRIPYLEE 97  Thermococcus kodakarensis KOD1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap