3M9S


Conserved Protein Domain Family
NADH_Oxid_Nqo15

?
pfam11497: NADH_Oxid_Nqo15 
Click on image for an interactive view with Cn3D
NADH-quinone oxidoreductase chain 15
This protein, Nqo15, is a part of respiratory complex 1 which is a complex that plays a central role in cellular energy production in both bacteria and mitochondria. Nqo15 has a similar fold to Frataxin, the mitochondrial iron chaperone. This protein may have a role in iron-sulphur cluster regeneration in the complex. This domain represents more than half the molecular mass of the entire complex.
Statistics
?
PSSM-Id: 402895
View PSSM: pfam11497
Aligned: 11 rows
Threshold Bit Score: 197.288
Threshold Setting Gi: 297165931
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3M9S_7           5 SERELYEAWVELLSWMREYAQAK-GVRFEKEADFPDFIYRMERPYDLPTTIMTASLSDGlGEPFLLADVSPRHAKLKRIG 83  Thermus therm...
WP_014684589     4 SDSALYAGWTELLGWLEAEAQAR-GLTYGKVADFPDYIYRMERPYDLPTTVMSAGVSSG-GQPLLVAAVSPRHADLKAVS 81  Deinococcus g...
jgi:Deipe_3674   4 NDTALYQQWIDLLGWMQDYAQQH-GLSYEKISDFPDYIYRMERPYDLPTTVASAGVGHP-GQPLLIAAVSPRHVRLKGVQ 81  Deinococcus p...
jgi:Trad_2536   44 QDAAFYRAWNDLLGWMREYADAHdGAIFEKEADFPDYIYRMERPYDLPTTIMSASLSDPkGRPVLLVNASPRHAVFKEVV 123 Truepera radi...
jgi:Mrub_2396    9 HEEMLYRAWVQVIEWMKEYAAEK-GVQFSKESDFPDFIYRMERPYQLPTTMMAVSLSDErGEPFFFASVSPRHAKLKHVA 87  Meiothermus r...
jgi:Mesil_1510  11 HDEMLYDAWVQVLEWMRQYAAEK-GVRFEKESDFPDFIYRMERPYELPTTIMAASLSDEaGEPFLIASVSPRHAEMKRIE 89  Meiothermus s...
WP_013703566     5 HDKALYEAWVEVLDWLKAYAVER-GVRFEWEADFPDYIYRMHRPYDLPTRVMTVSLSDErGEPFFLADVSPRHAKLKQIS 83  Marinithermus...
WP_013457383     1 msHAIYDAWVQLMGWLEEYAAEH-DLVFDREADFPEFIYRMHKPWELPTRTMTVSLSRAnDEPFFVASVSQPSDEQKHVS 79  Oceanithermus...
Q9RWE2          27 DKAALYRQWVELLGWLGDEARSR-GLSIDKVADFPDYIYRMERPYDLPTTVMSVNVSQD-GQALLVAAVSPRHVDLGGIS 104 Deinococcus r...
WP_011529844     5 QDERLYTQWVELLGWLEAEASTR-GLGFEKVADFPDYIYRMERPYDLPTTVMSVALTVG-GQPLLLAAVSPRHVDLKGIS 82  Deinococcus g...
ACO46138         5 SDSALYAQWVELLSWLQEEAAAR-GLSFEKVADFPDYIYRMERPYELPTTVMSVSLSAG-GQPQIVAAVSPRHADLKAVS 82  Deinococcus d...
3M9S_7          84 LRLPRAHIHLHAHyePGKGLV-TGKIPLTKERFFALADRAREA 125 Thermus thermophilus HB8
WP_014684589    82 LRLMGGSKHWHLH--AGTRGLlEGKRPFTRERLGAVLDGALRG 122 Deinococcus gobiensis
jgi:Deipe_3674  82 LRLMGGSKHWHLH--AGDSGLlEGKRPFTRERLFAILDGALMG 122 Deinococcus peraridilitoris DSM 19664
jgi:Trad_2536  124 LHPFESHTYRKLTynPQKGALaEGKRPFTKAMLFELADALFHS 166 Truepera radiovictrix DSM 17093
jgi:Mrub_2396   88 FRVPGGHVHYHAHweEGQGLVlEGKFPLTKEKLYQMADRARAA 130 Meiothermus ruber DSM 1279
jgi:Mesil_1510  90 LRVPGAMLHWHAHweDGRGLViGGKLPLDKVRLYQLADRAREA 132 Meiothermus silvanus DSM 9946
WP_013703566    84 FRVPGGHLHWHAHyeEGRGLVlGGKIPLTKEKLYQLADRARHH 126 Marinithermus hydrothermalis
WP_013457383    80 LRSPGAHLHWHAHe-HGGGLElSGGIKLDKTKLFALLDQARRD 121 Oceanithermus profundus
Q9RWE2         105 LRLMGGSKHWHLH--AGAGGLlEGKRPFTRERLSVLLDGVMRG 145 Deinococcus radiodurans
WP_011529844    83 LRLMGGSKHWHLH--AGERGLlEGQRPFTRERLAVLLNGALRG 123 Deinococcus geothermalis
ACO46138        83 LRVMGASKHWHLH--AGDGVLlEGKRPFTRARLQTLLDSAMRG 123 Deinococcus deserti VCD115
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap