2FQH


Conserved Protein Domain Family
Ta0938

?
pfam11494: Ta0938 
Click on image for an interactive view with Cn3D
Ta0938
Ta0938 is a protein of unknown function however the structure has been determined. The protein has a novel fold and a putative Zn-binding motif. The structure has two different parts, one region contains a beta sheet flanked by two alpha helices and the other contains a bundle of loops which contain all cysteines in the protein.
Statistics
?
PSSM-Id: 402892
View PSSM: pfam11494
Aligned: 11 rows
Threshold Bit Score: 149.071
Threshold Setting Gi: 429132869
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2FQH_A          17 SKGCALCGATWGDYHADFLGEDLFFCCDICAAEFMNMMDEAFKHTARHNVDELHIDGNYQLGRNVLLKNGEDRLRFYVKF 96  Thermoplasma ...
WP_012020943    14 EKGCALCGATWGGWYEDVDGERLFFCCDVCAREFLNMLNRVKEITGWGKVDELIINGDYYRGRNCEAKSEGKSLSFYVKF 93  Metallosphaer...
jgi:Cmaq_0590   14 ETGCALCGATWGEYYDEVDGEKLFFCCDLCAKGFKNIINEIKRRTGWSRIDKLTMVGNYYKGRTGVAMHGNEQFKFYVKF 93  Caldivirga ma...
Q4J6Q4          14 ETGCALCGGTWGDYYEEIDGEKLFFCCDICALEFVNMLREVKKRTGWDRIDELVINGNYSSGRTCVSKRGGREYKFYVRF 93  Sulfolobus ac...
WP_048098485    14 EKGCALCGATWGEYYDVIDGENLFFCCDYCALEFKNMVNEVKNRTRWSKIYELVINGNYYTGRTCIAKSEDKEYKFYVKF 93  Candidatus Ac...
Q96XA7          14 ETGCALCGATWGEYYEEIDGDRLFFCCDFCALEFKNMINEVKKRTGWSKIDELIINGNYYTGRTCVAKLGEKEYKFYVKF 93  Sulfurisphaer...
OWP56056         6 KEGCGLCNATWGEYYREIDGDRMFFCCSVCADIFENMVAEVKNRTGWKSIDYVELIGNYSAGRNCTARSGKSTFKYYFRT 85  Thermoplasmat...
EQB69460         9 EKGCALCDATWGEYYREIEGENMFFCCNICADIFENMVNEVKKRTGWSHIDYIQLVGNYSKGRECEARSDKSVYKYYFRT 88  Thermoplasmat...
EQB71839         6 SEGCALCNATWGEYWREIDGENMLFCCNICADIFQEMVRKVKENTGWEKVDYVNLQGNYSKGRNCTATNGDRKYSYYFRT 85  Thermoplasmat...
EQB65919         5 YDGCALCDATWGDYWREVEGERMFFCCSICADAFENMVKRVKKETGWGKIDSISIEGNYSRGRDCVATNGKEKVEFFFR- 83  Thermoplasmat...
jgi:Calag_0093  14 ETGCALCGGTWGDYYETVEGEKLFFCCNICAKAFINIINEAKKRFNLNKIDYIELRGNFYRGRNIEVKNGENSHKFYIKL 93  Caldisphaera ...
2FQH_A          97 GPGAVIKEFKIT 108 Thermoplasma acidophilum
WP_012020943    94 GEDAEITTFIIK 105 Metallosphaera sedula
jgi:Cmaq_0590   94 NDDADITIFNEL 105 Caldivirga maquilingensis IC-167
Q4J6Q4          94 NEDAGVETFREV 105 Sulfolobus acidocaldarius
WP_048098485    94 NDEAGIETFKEL 105 Candidatus Acidianus copahuensis
Q96XA7          94 NEEGDVGIFKEV 105 Sulfurisphaera tokodaii
OWP56056        86 YSDGRMMKFEER 97  Thermoplasmatales archaeon B_DKE
EQB69460        89 YGDGRMMTFEDR 100 Thermoplasmatales archaeon Gpl
EQB71839        86 YSDGKFITFQER 97  Thermoplasmatales archaeon A-plasma
EQB65919        84 HEDGIITEFRVK 95  Thermoplasmatales archaeon I-plasma
jgi:Calag_0093  94 SDDGDITEFKEI 105 Caldisphaera lagunensis DSM 15908
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap