2BVB,2K2S


Conserved Protein Domain Family
TgMIC1

?
pfam11476: TgMIC1 
Toxoplasma gondii micronemal protein 1 TgMIC1
TgMIC1 is released as part of a complex by Toxoplasma gondii prior to invasion. The complex which consists of TgMIC4-MIC1-MIC6 participates in host cell attachment and penetration and is critical in invasion. This is the C terminal domain of TgMIC1 which has a Galectin-like fold which interacts with and stabilizes TgMIC6 providing a mechanism for an exit from the early secretory compartments and trafficking of the complex to micronemes.
Statistics
?
PSSM-Id: 402882
View PSSM: pfam11476
Aligned: 3 rows
Threshold Bit Score: 256.971
Threshold Setting Gi: 224036168
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2BVB_A     1 KTEIHGDSTKATLEEGQQLTLTFISTKLDVAVGSCHSLVANFLDGFLKFQTGSNSAFDVVEVEEPAGPAVLTIGLGHKGR 80 
ESS33997 320 KTEIHGDSTKATLEEGQQLTLTFISTKLDVAVGSCHSLVANFLDGFLKFQTGSNSAFDVVEVEEPAGPAVLTIGLGHKGR 399 Toxoplasma gondii VEG
2K2S_A     1 KTEIHGDSTKATLEEGQQLTLTFISTKLDVAVGSCHSLVANFLDGFLKFQTGSNSAFDVVEVEEPAGPAVLTIGLGHKGR 80 
2BVB_A    81 LAVVLDYTRLNAALGSAAYVVEDSGCSSSEEVSFQGVGSGATLVVTTLGESPTAVSA 137
ESS33997 400 LAVVLDYTRLNAALGSAAYVVEDSGCSSSEEVSFQGVGSGATLVVTTLGESPTAVSA 456 Toxoplasma gondii VEG
2K2S_A    81 LAVVLDYTRLNAALGSAAYVVEDSGCSSSEEVSFQGVGSGATLVVTTLGESPTAVS- 136
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap