2B2A


Conserved Protein Domain Family
N-Term_TEN

?
pfam11474: N-Term_TEN 
Click on image for an interactive view with Cn3D
Telomerase reverse transcriptase TEN domain
This is the N terminal domain of the protein telomerase reverse transcriptase called TEN. The TEN domain is able to bind both RNA and telomeric DNA and contributes towards telomerase catalysis. The TEN domain has a structure that consists of a core beta sheet surrounded by seven alpha helices and a short beta hairpin.
Statistics
?
PSSM-Id: 151913
View PSSM: pfam11474
Aligned: 3 rows
Threshold Bit Score: 303.572
Threshold Setting Gi: 90108787
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2B2A_A   12 INNINNNKQMLTRKEDLLTVLKQISALKYVSNLYEFLLATEKIVQTSELDTQFQEFLTTTIIASEQNLVENYKQKYNQPN 91  
Q22ZB5    4 INNINNNKQMLTRKEDLLTVLKQISALKYVSNLYEFLLATEKIVQTSELDTQFQEFLTTTIIASEQNLVENYKQKYNQPN 83   Tetrahymena thermop...
Q22ZB5    4 INNINNNKQMLTRKEDLLTVLKQISALKYVSNLYEFLLATEKIVQTSELDTQFQEFLTTTIIASEQNLVENYKQKYNQPN 83   Tetrahymena thermop...
2B2A_A   92 FSQMTIKQVIDDSIILLGNKQNYVQQIGTTTIGFYVEYENINLSRQTLYSSNFRNLLNIFGEEDFKYFLIDFLVFTKVEQ 171 
Q22ZB5   84 FSQLTIKQVIDDSIILLGNKQNYVQQIGTTTIGFYVEYENINLSRQTLYSSNFRNLLNIFGEEDFKYFLIDFLVFTKVEQ 163  Tetrahymena thermop...
Q22ZB5   84 FSQLTIKQVIDDSIILLGNKQNYVQQIGTTTIGFYVEYENINLSRQTLYSSNFRNLLNIFGEEDFKYFLIDFLVFTKVEQ 163  Tetrahymena thermop...
2B2A_A  172 NGYLQVAGVCLNQYFSVQVKQKKWYKNN 199 
Q22ZB5  164 NGYLQVAGVCLNQYFSVQVKQKKWYKNN 191  Tetrahymena thermophila SB210
Q22ZB5  164 NGYLQVAGVCLNQYFSVQVKQKKWYKNN 191  Tetrahymena thermophila SB210
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap