2AL3


Conserved Protein Domain Family
TUG-UBL1

?
pfam11470: TUG-UBL1 
TUG ubiquitin-like domain
TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly. TUG releases the GLUT4 containing vesicles to the cellular exocytic machinery in response to insulin stimulation which allows translocation to the plasma membrane. TUG has an N-terminal ubiquitin-like domain (UBL1) which in similar proteins appears to participate in protein-protein interactions. The region does have a area of negative electrostatic potential and increased backbone motility which leads to suggestions of a potential protein-protein interaction site. This domain is also found at the N-terminus of yeast UBX4.
Statistics
?
PSSM-Id: 402879
View PSSM: pfam11470
Aligned: 100 rows
Threshold Bit Score: 50.5784
Threshold Setting Gi: 126135336
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2AL3_A        15 LAPNGRRHTVKVTPSTVLLQVLEDTCRRQDF-NP-SEYDLKFQR-TVLDLSLQWRFANLPNNAKLEM 78 
XP_007798859   8 VDSNFRQVEIKVNPATHLTDILEQACAKFKT-DP-SKHLLKHKQ-RQLDLSHTWRTSGLVQGAKLEL 71  Eutypa lata UCREL1
CCD42291       8 IDKSFNRATIKVTPGTYMSEVVSEACKKLGK-KS-TNYDLKRNNdKAIDLSQTYRQTGLTTGAKLTL 72  Botrytis cinerea T4
XP_008076888   8 tDTAFRRQTVKVTPGIYMTDVLGEACRKFGV-KS-ANYTLKYKG-KPVDLSRTYRQTGLVSGAKLEL 71  Glarea lozoyensis ATCC 20868
EPS43152       7 ngPNQRRLNVKVTPGTVLNDVLNQACDRFGL-SA-DSFTLRHGK-TNVDLTLPFRLSRLGPGAKLDi 70  Dactylellina haptotyla CBS 2...
XP_002842288   8 VIYGGRRASIKAPPTRSLSEIHTEACIKFGV-DP-QNFALKKGN-AALDLSLQIRLTNLSPGAKLDL 71  Tuber melanosporum Mel28
CCX34468       6 vfFNKRQATIKTNPGKSLSDIRTEACAKFGL-TPaSNFILKRNG-TKLDLSLPIRLTGLVPGAKIDL 70  Pyronema omphalodes CBS 100304
EXX71781       8 llNGGKRQPIKTTPMMPLKEIIKLVCNKQGYtDV-ENYGLKQNK-TILDLSLSVRFANLAPGAKLEL 72  Rhizophagus irregularis DAOM...
EGF77742      10 dgspiKKTIIKTTPSMSLKSIVVQSCEKLGLkNP-DLYMLKNKR-DTLDLSLSVRFANLAPGAKLTL 74  Batrachochytrium dendrobatid...
XP_018230831   7 ILSNARRYTIKTNPTQLINDLLLEGCKKAGQlDP-QEYTLKYGS-SVLDLSLPIRLARLPAGAKLML 71  Pneumocystis jirovecii RU7
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap