1Z0J,1Z0K


Conserved Protein Domain Family
Rbsn

?
pfam11464: Rbsn 
Rabenosyn Rab binding domain
Rabenosyn-5 (Rbsn) is a multivalent effector with interacts with the Rab family.Rsbn contains distinct Rab4 and Rab5 binding sites within residues 264-500 and 627-784 respectively. Rab proteins are GTPases involved in the regulation of all stages of membrane trafficking.
Statistics
?
PSSM-Id: 402875
View PSSM: pfam11464
Aligned: 96 rows
Threshold Bit Score: 40.4259
Threshold Setting Gi: 444705541
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1Z0J_B        16 QQIDNIKAYIFDAKQCGRLDEVEVLTENLRELKHTLA 52 
XP_011403953 518 LQRQQLLGYIAQAEQAKRFDEVATLKESLHEIEALMV 554 Amphimedon queenslandica
PDM70088     595 VQRMQVKSFLQQAADAGKVDDARILEENLRMIDEELM 631 Pristionchus pacificus
EGT50421     514 EQREQLRKFLFQASSTGKMDEMDILERNLKEIEDEMT 550 Caenorhabditis brenneri
EKC20228     498 QQMNIIRSYIKQARQAGKLDEVQMLEQNLKELQNEYL 534 Pacific oyster
XP_002601782 473 QQMDIIRSFVDQARAAGRLDEVEMLEANLRELQQEYW 509 Florida lancelet
XP_786891    490 QQMNIISSYLNQAQEAGRWDEVNMLEANLKDLQLAYR 526 purple sea urchin
XP_001606370 473 EQMSNLRFYIKQAREECKFEEVATLERNLKELQSAYF 509 jewel wasp
XP_001951022 391 EQMNIIKNYIKQAKEAYRFDEVASLERNLQELNEEYF 427 pea aphid
XP_014271881 411 EQINIIRSYIKEAKAAHKYDEVASLEENLQELKKEFW 447 brown marmorated stink bug
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap