Conserved Protein Domain Family
DUF2950

?
pfam11453: DUF2950 
Protein of unknown function (DUF2950)
This is a bacterial family of uncharacterized proteins.
Statistics
?
PSSM-Id: 402867
View PSSM: pfam11453
Aligned: 33 rows
Threshold Bit Score: 335.738
Threshold Setting Gi: 123383485
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012646467   38 QQIFTSPEEARERLTAAVDSRNFLELKKMFGSGYQDL-DPGDpvQRSEEFGHFSRHLKEGAELVME-----GDYRAILKI 111 Geobacter dalt...
Q1LCB2         34 E-VFATPEAAMTAFGNAVINDDEPTLQKLFGGKFRDIiPP----VGAEVRSKFLTAWGKSHAVDQK------ENRAYIDV 102 Cupriavidus me...
Q1LMP9         32 QKSFATPEAAMNAFGDAVTTSNDTAIDTMFGNQARRLiPP----LGAEIRYKFLSAWSQSHSIQKQ-----DDNTARIAV 102 Cupriavidus me...
Q0KC58         36 QKPFKTPEAAMNAFGEAVATSDDDAMKVLLGARFHDLiPP----VGADIRYRFLEAWRISHAVKPE-----GDSHARIAV 106 Cupriavidus ne...
jgi:Bphy_5885  36 QKTFTSPEAAMKAFGDAVVKDREDALRTIFGDDFRKLiPP----AGAAVRDTFVAEWAKSHTIEPV-----EAGHTHIVV 106 Paraburkholder...
WP_012406351   37 QKNFSSPDAAMNAFGEAVANNEEATLQSLFGRDFRELiPP----AGVEVRSRFIDAWGKSHEIQQT-----DDHHAHIAV 107 Paraburkholder...
Q1LGB1         29 QHVYPTPDAAADAFGDAVARSDPDALKQVLGANYEKLvPPG---LSQNDIYDFLAAWASHHAVQPD-----GDKAARIEV 100 Cupriavidus me...
Q0JZG7         36 QQVFPSPDAAAEALGDAIARSDGDALQRVLGKQYQSLvPEGS--INRDDVYEFLGAWARHHAVQPD-----GERRALIAV 108 Cupriavidus ne...
SAL19027       33 QAVYPTAEAAAEALTDAIATNDETALAKVLGKDHRRYvPEGA--IGREDIYAYLGAWAQQHRIVEDkepldGRPAAHIEA 110 Caballeronia c...
jgi:Bphy_1474  34 QTVYPTPEAAADALVDAVATSDHPAMEKVLGKNYGRYiPTTN--IGEDDIYAFLGQWAKGHRIVDDpaprhGRKSVHLAV 111 Paraburkholder...
WP_012646467  112 GKEKWPFPVPVIRKGNGWLFDTKAGRDEILNRRIGRNELLAINACLAYVEAQREYYNMpEPDGVQIPKYAQRLISSQGRH 191 Geobacter dalt...
Q1LCB2        103 GDDGWTFPIPLVKGSKGWQFDTLAGVEEMRVRRVGRNELAVIQTMLAITDAQAEYALT-LHDGSKTLVYASKLSSTPGKQ 181 Cupriavidus me...
Q1LMP9        103 GNDGWTMPIPLVRRNGQWQFDTQAGLTEIRLRRIGRNELSTIQTMLAVYDAQREYAST-DHVGDGMMVYAAHLVSSPGKR 181 Cupriavidus me...
Q0KC58        107 GNDGWTLPVPLVKTSKGWQFDTRAGVDEMRIRRIGRNELAVIQAMLAVYDAQREYART-DHDGDGLLAYAGKLASTPGKQ 185 Cupriavidus ne...
jgi:Bphy_5885 107 GDSGWTFPVPLVKTGQGWRFDTRAGAEEMRLRRIGRNELAVIQTMLAIYDAQREYAQT-AHDGEGVLAYASRMVSSSGKH 185 Paraburkholder...
WP_012406351  108 GGDGWTFPIPLVKSAEGWHFDTGAGAEEMRLRRIGRNELAVIQAMLAVYDAQREYALT-DHDGDGLLSYASKLSSSPGKQ 186 Paraburkholder...
Q1LGB1        101 GGSGWTFPVPLAKRKTGWQFDLAAGEQEMRRRRIGRNELVAMDTLLQLADAQQRYAEQ-----IGNGKYAHQLVSTPGKT 175 Cupriavidus me...
Q0JZG7        109 GQSGWTFPVPLAKQKDGWQFDLRAGQQEVRRRRLGRNELVTMETLLQLADAQQRYAEQ-----VGLGRYATQLISAPGKT 183 Cupriavidus ne...
SAL19027      111 GTSGWTLPIPLVKVAKGWRFDMRAAHDEMLTRRIGRNENSAMQVALAYVAAQNDYRKA-------ADRYADRFVSTSGKH 183 Caballeronia c...
jgi:Bphy_1474 112 GDGDWTLPIPIVQSARGWQFDTPAATDEMLTRRIGRNERAAILTSLAYVDAQNDYRSQ-------MQHYAQKFISSPGRH 184 Paraburkholder...
WP_012646467  192 DGLYWPTLPGSKESPLGPLITKAKeKGYMQerakgengSRPINGYYFHILK-QQGASAPGGRFSYIINGNMVAGHALIAY 270 Geobacter dalt...
Q1LCB2        182 DGLYWASAPGEPQSPLGAAFRGAG-TSHAS--------KDGYYGYHYKLLD-AQGPNAPGGAYSYVVNGNLFGGFAVLAW 251 Cupriavidus me...
Q1LMP9        182 DGLYWPTSAGEPESPLGSAFLRAV-GRNAS--------AEGYNGYRYKLLT-SQGPAAPGGQYNYLVNGRLFGGFAVLAW 251 Cupriavidus me...
Q0KC58        186 DGLYWPTSDGAPPSPLGAAFLTAG-QRNPG--------QGGYYGYHYKLLT-AQGPNAPGGAYNYVVNGKLFGGFAVLAW 255 Cupriavidus ne...
jgi:Bphy_5885 186 DGLYWPTGPGEPASPLGDAFVDAS-SRNAK--------NAGYYGYHYKLLD-SQGPHAPGGAYGYVVHGKLFGGFAVIAW 255 Paraburkholder...
WP_012406351  187 DGLYWPTQADAPPSPLGPAFIQAS-TRKAG--------DTGYHGYHYKLLT-SQGPHAPGGAYDYLAHGKLFGGFAVIAW 256 Paraburkholder...
Q1LGB1        176 NGLYWPSASAENDSPLGPDALAMG-PEVPP--------EEAFYGYRYRIIApPKGSDAK---------------FAFIAW 231 Cupriavidus me...
Q0JZG7        184 NGLYWPAASEQDASPIGPDALAMG-PDTPA--------ADAFYGYHYRILPpAKGSDAK---------------YGLIAW 239 Cupriavidus ne...
SAL19027      184 DGLYWHSAPGEPDSPLGPLAATMP-NKPTD--------KDGYYGYHYRILT-AQGAHAQGGAKNYMQGGQLKDGFGLIAT 253 Caballeronia c...
jgi:Bphy_1474 185 DGLYWPTAEGEPESPLGPLAATMP-RQIAP--------GEAYYGYHYRILT-SQGAHADGGAQSYLQDGTLTKGFGLVAW 254 Paraburkholder...
WP_012646467  271 PARWGVSGIMTFIVNQRGRVYQKNLGPETTRIARAMKAYNPDLTWKVV 318 Geobacter daltonii
Q1LCB2        252 PARYQDTGVMSFMVSHDGQVYERDLGADSAVKAKEIRNFDPGAGWRKV 299 Cupriavidus metallidurans CH34
Q1LMP9        252 PVKYGETGIKSFIVNHEGQVYERDLGKNTSARADGIQSFDPVPGWSKV 299 Cupriavidus metallidurans CH34
Q0KC58        256 PVRYGDTGVKSFMVSHDGQVYERDLGPDSAGKAAATKTFDPGPGWSKV 303 Cupriavidus necator H16
jgi:Bphy_5885 256 PVKYGETGIKSFMVSHAGQVYQRDLGPDSAAKAEATKSFDPGPGWSKV 303 Paraburkholderia phymatum STM815
WP_012406351  257 PARYGDTGIKSFMVSHAGQVYERDLGPDSAEKAKATTSFDPGPGWAQV 304 Paraburkholderia phymatum
Q1LGB1        232 PARYGDSGIHSFMVDSERRFYERDLGKSTGTRAGAMRAFSP-EGWERa 278 Cupriavidus metallidurans CH34
Q0JZG7        240 PARYGDTGVHSFMLGSDRVFYERDLGPGTASRAKAIRSFSP-AGWQRV 286 Cupriavidus necator H16
SAL19027      254 PARYGQTGVMTFIVNQDGQIYEKDLGPASIQRAAAIKSFDPDSSWQAV 301 Caballeronia cordobensis
jgi:Bphy_1474 255 PAEYGKTGVMSFIVNQNGQVYEKNLGPQTPRVAAAITSFNPDSSWQAt 302 Paraburkholderia phymatum STM815
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap