Conserved Protein Domain Family
ArsP_2

?
pfam11449: ArsP_2 
Putative, 10TM heavy-metal exporter
This is a family of putative manganese transporters with 9-11 TMs. Members carry two well-conserved characteristic sequence- motifs of 'PGCG'.
Statistics
?
PSSM-Id: 402864
View PSSM: pfam11449
Aligned: 18 rows
Threshold Bit Score: 392.817
Threshold Setting Gi: 492945202
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ELY39529              3 DPVGILLGSVRDGFVQVGAFVAITVVLFSYLQ--YRTgGRLVERLERNERAQPLIGALLGLTPGCGGAIVMMPLYVRGSV 80  Halalkal...
Q3IGV7               38 NLRAITITALSDAFFQVSVFVAATLLIYYYAIarLPQ-LELSYLSAKSPILEVAFASILGALPGCGGAIIVVTQFTKGQA 116 Pseudoal...
WP_012944807          3 ELLTVLLESLRDGYVQVSAFVAVTVLAFGLIQ--YRTdGAVLSVIEENERLQVLFGGLLGLTPGCGGAIVVMPLYVRGTV 80  Haloterr...
WP_006054219          6 EAIDIFVFSVRDGFVQVSAFVAITVLLFSYIQ--YRTgGRIVSYLESHERMQPIAGALLGLTPGCGGAIIAMPLYIRGTV 83  Halogeom...
jgi:Halar_0967        6 QAIEIFIFSVRDGFVQVSAFVAVTVLLFSYIQ--YRTgGRLITALEENERYQPLVGGLLGLTPGCGGAIVAMPLYIRGTV 83  halophil...
jgi:Marme_2307       42 TLSEDIASVLADAFLQVSAFVAATLALYYGIShhFNS-SKIQQWMQHRPYTEVIFAGIMGVLPGCGGAIIVITQYTQRKI 120 Marinomo...
CAV19179             40 ATRELTVTTLSDAFWAVSCYVALTLAIYHWLSlyINKdNVFNKLVHQSRSNQVVFAALMGALPGCGGAIVVTTQFISGKL 119 Vibrio t...
JLExeter:vfu_A01651  51 NTRELAVQTLSDSFWAVSTYVALTLAIYHYVSrwMNGtNRFVVAFHQSRQVQVLIASLLGALPGCGGAIVVTTQFVSGKV 130 Vibrio f...
Q9KRF4               53 NTRAVTVETLADSFWAVSTYVAFTLAIYHWVSrwLDGaHALVSAYHRSRNLQVVIAALLGALPGCGGAIVVTTQFVSGKV 132 Vibrio c...
Q6LFS2               38 NTREITISVLSDAFWQVATYVAATLAIYHAISsrLSNtNKLTGLLNKSTYFQVLFSASMGALPGCGGAIVVITQYVKGRL 117 Photobac...
ELY39529             81 SFGTVVATLIATAGDSAFVLLALAPEAALYAYGISFGAAIVSGYAIDRFGlgvgrvdravarlrptatDGG-VVSGTAGA 159 Halalkal...
Q3IGV7              117 SFGAIVAVLAATMGDAAFLLLATRPTEGVIIMGIGLVVGTLSGLIVNAIH------------------KKDfLRPLPQQH 178 Pseudoal...
WP_012944807         81 SFGTVVATLGATAGDSAFVILALAPEAALYAYAIAFAASVATGYLVDSVGlgvtrvddavaklspamaDGGtVVNGGVGP 160 Haloterr...
WP_006054219         84 SFGTVVAALAATAGDSAFVILALAPKAAAYAYAMAFVAAILFGYAIDIWGlgvgrvdravnrisrpmtDGGfTTTNVADG 163 Halogeom...
jgi:Halar_0967       84 SFGTVVAALGATAGDSAFVILALAPEAAIYAYGLAFISAVSFGYAIDWWGlgvgrvdravakmgrpltDGGfATTSVANG 163 halophil...
jgi:Marme_2307      121 GFGAVVAVLTSTMGDAAFLLISQKPVDAIIVLSISVSVGIVSGLVVNKINpnpnllpehtnlekqahpDTAlLTPTIADI 200 Marinomo...
CAV19179            120 GFGAVVAVLVSTMGDAAFLLIASEPKTGLAMMAMGVIVGTASGRIINLFH------------------ADDfLRPKQAER 181 Vibrio t...
JLExeter:vfu_A01651 131 GFGSLVAVLTATMGDAAFLLLASQPLTGLGVIGVGIVTGCVTGLVVNALH------------------RDDfMRPKQEKL 192 Vibrio f...
Q9KRF4              133 GFGALVAVLTATMGDAAFLLLASQPVTGLYVIGIGVVTGCITGLVINALH------------------RDDfMRPALTEL 194 Vibrio c...
Q6LFS2              118 SFGSVVAVLTATMGDAAFLLLAAQPKTGLLVISVGFVVGLLSGWTVDAIH------------------GEHfMRPAIKDA 179 Photobac...
ELY39529            160 NPAanpgheydgvacshdhsrkrepgFMTWLSHAAHVAWWATALVALIAGTVyllrgapdvaMTVAPTFEGAF------- 232 Halalkal...
Q3IGV7              179 KQQvi--------------------qLPTAIIKISKPVWMVAIVPSLIIALL----------IAFNVDFKKWDtnipnii 228 Pseudoal...
WP_012944807        161 NPThdycgpapaha--heagpdresrVLTPLSHLAHVLWWVAAVAGLVLGSLyllrggpevaLTAGLSFDGLF------- 231 Haloterr...
WP_006054219        164 GPSipnyemdqsch-dhghgtgddsgLLTTISHGVHVLWWGVAVAGLVAGVLylvrgapevpLEFAPTFFGLF------- 235 Halogeom...
jgi:Halar_0967      164 GPSvtdyegaacah-dhgkpegaknsVMTTVSHGVHVLWWFVAAAGLIAGVEylrrgapdvpLEFGLTFAAVF------- 235 halophil...
jgi:Marme_2307      201 WLS-----------------------------RISIAFWCMLIIPATIIAFL----------LAMQYDVNALLalpdksi 241 Marinomo...
CAV19179            182 NEAensctsq----------pqgqspVSKKAINLQGYLWSVLIIPGAAVALL----------GSFQIDVNQLLtlpemsm 241 Vibrio t...
JLExeter:vfu_A01651 193 PESlpha---------------petpLAQTALNLQGTFWKWLLVPASLVAFA----------QSFQIDINAQLgfpelti 247 Vibrio f...
Q9KRF4              195 SNKlrtscc------------satstVSFKAINLQGLFWKYLLLPASLVAFA----------SSFQIDINQVLslpemsi 252 Vibrio c...
Q6LFS2              180 PIPsctnkk----------------eahqpPLKLQGHFWKWMLLPASVIAIM----------GSFQINIDHFFhlekgti 233 Photobac...
ELY39529            233 TVAGITGSILSVYLYAVGRRYIGEGGVGHVRESFHSAYDt-FQHAAMETSFVTVWVIAGYLLYEYVVQFGNVDIAAFAAA 311 Halalkal...
Q3IGV7              229 SFFGAAMALFIVSIWAYSSKGESYKEVTAEDDACKRNPPsnITKVLQDTHFVTAWVVASFMLFEILVNVAGLDLKAWFLH 308 Pseudoal...
WP_012944807        232 TITGIVGAALSLYLYAIGRHYVGEGEIARARDSFGSIYDt-LTHAAMETSFVTVWVLVAFLVYEYAVLLTGIDVTTVAAA 310 Haloterr...
WP_006054219        236 TIAGLVGTTASFYLHFVGRRFIGEGEAGRIRDDFTSAYEt-FQHAAMETSMVTVWVIAAYLIYEYSIVIFSIDIGAIAAA 314 Halogeom...
jgi:Halar_0967      236 TVAGLLGTVASFYLHFVGRRFIGEGEAGRVREEFANAYEt-FQHAAMETSMVTVWVIAAYLLYEYSVVIFAIDIGGLAAA 314 halophil...
jgi:Marme_2307      242 ETLGAISGFACLCLWAMSAKSDRYSELAKENENILPKHW--IRKVAQDTQFVTSWVVVAFIVFELILHIFGEDVLNILHS 319 Marinomo...
CAV19179            242 EWTGTILLISSMFLWGLTREIEDYKSAVSEDEKCIGSHP--LQKTAQDTNFVTAWVVVAFLFFEFGSVLANVDFATLFSS 319 Vibrio t...
JLExeter:vfu_A01651 248 EWLGALLAVVSMLLWALTRELDTYQDAVSEDCKTRQAHP--LQKAAQDTNFVSAWVILAFLAFELAHHFTGWEVSQEWQH 325 Vibrio f...
Q9KRF4              253 EWIGALLAVSSMLLWALTQEIEDYQSTVSEDDKIRTSHP--MQKAAQDTNFVSAWVIIAFLAFELTLHFTGFEIGANWGN 330 Vibrio c...
Q6LFS2              234 NIIGAAAAIVSIILWAISRDITDYESAVSEDPKEQANTL--FQRVAQDTNFVTSWVICAFLLFELTMYWTGINLASAFTE 311 Photobac...
ELY39529            312 AGLLAPVGGALLGLIPGCGPQIVLAGVYAEGAIPFSALTANAISQDGDALFPLIAMDKTAAIVASIYTTVPALVVGIALH 391 Halalkal...
Q3IGV7              309 YAYLAPLIAVLIGFLPGCGPQIIVTTLYIQGIIPFSALTANAISNDGDALFPAIAMAPKAALIATFYTAIPALAVGYGLY 388 Pseudoal...
WP_012944807        311 AGVLAPIGGAVVGLIPGCGPQILLASVYAEGGLPFSALTANAIAQDGDALFPLLAVDARAAIVATIYNFLPAVVVGVALH 390 Haloterr...
WP_006054219        315 AGVLAPIGGALLGLIPGCAPQIVFAQVYAQGGIPFSALTANAISQDGDALFPLMAIDMKAAIVATIYTTIPALIVGIVLY 394 Halogeom...
jgi:Halar_0967      315 AGVLAPIGGALLGLIPGCAPQIIFAGVYAEGGIPFSALTANAISQDGDALFPLLAIDPKAAMVASIYTTIPALIVGVLVH 394 halophil...
jgi:Marme_2307      320 LGSTSILFATVVGLLPGCGPQIMVTGLYIQGAIPLSAQLANAISNDGDALFPAIALAPKAAFLATVYSTIPAVIAGYAYY 399 Marinomo...
CAV19179            320 WGMMLPLAGVLMGLLPGCGPQLLVTSLYLSGALPLSAQVGNAISNDGDALFPAIAMAPKAALVATLYSGIPALICAYGYW 399 Vibrio t...
JLExeter:vfu_A01651 326 WGVWMPAVGILVGMLPGCGPQILITSLYLAGSVPLSTQLSNAISNDGDALFPAIALAPKAALFATLYTAIPAIVVGYGYY 405 Vibrio f...
Q9KRF4              331 WGVWMPALGIMIGLLPGCGPQILVTSLYLSGALPFSAQLSNAISNDGDALFPAIALAPKAALMATLYSSIPAAIVGYGYF 410 Vibrio c...
Q6LFS2              312 WSAYIPLMGVVIGLLPGCGPQILVTSLYISGAVPLSAQLGNSISNDGDALFPAIVLAPKAALMATIYSSIPAVIVAYGYY 391 Photobac...
ELY39529            392 VV 393 Halalkalicoccus jeotgali B3
Q3IGV7              389 FW 390 Pseudoalteromonas haloplanktis TAC125
WP_012944807        391 LL 392 Haloterrigena turkmenica
WP_006054219        395 AV 396 Halogeometricum borinquense
jgi:Halar_0967      395 YF 396 halophilic archaeon DL31
jgi:Marme_2307      400 WI 401 Marinomonas mediterranea MMB-1
CAV19179            400 FM 401 Vibrio tasmaniensis LGP32
JLExeter:vfu_A01651 406 WL 407 Vibrio furnissii NCTC 11218
Q9KRF4              411 WL 412 Vibrio cholerae
Q6LFS2              392 YL 393 Photobacterium profundum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap