Conserved Protein Domain Family
DUF2828

?
pfam11443: DUF2828 
Domain of unknown function (DUF2828)
This is a uncharacterized domain found in eukaryotes and viruses.
Statistics
?
PSSM-Id: 402858
View PSSM: pfam11443
Aligned: 66 rows
Threshold Bit Score: 717.849
Threshold Setting Gi: 1002837616
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EHK18098      94 TENADVAFRSTQNALVDLFFELEDVVSGPRLKELLDAAWAVHPLITLKIIFNARSIHLGKSSKNVFYRAAGWLATNHPLT 173 Trichoderma vir...
EJT75764     125 TENGDIAHRSSKNALVDLFFELEDTISSPRLVEVLTAAWAEDPQTTLKIIFNARSIHLGKSSKTLFYRCTGWLAQNHPLT 204 Gaeumannomyces ...
EMR63341     156 TENKDLAHRSTGSSLVDLFTSLEKTISGPHLLELLKASWVEDPMLTLKVIFNARSIHLGKAEKSSFYQCAGWLAQNHPLT 235 Eutypa lata UCREL1
XP_001903562  96 TENGDVTFRSSNSVLVDLFSELEEVIDSNRLDSILTAAWAEDPLATLKIIFNARSIHLGKSSRISFYRCAGWLAEHHPLT 175 Podospora anser...
EON67117     115 TENADLTYRTTQSPLVDLFFSLEKQIAPEKLQSLLDASWNEDPLTTLKIIWSGRSIHLGRGERGTFYRCVGWLAKHHPLT 194 Coniosporium ap...
XP_007672588   3 TENADVAYRTSGEPLVDLFYELEDVISSRRLRQVLERAWDKDSEATLKIIWNARSIHLGKSSRGTFYRAVGWLAQEHPAT 82  Baudoinia panam...
XP_003046418 117 TENSDLAYRSTKDALVDLFQELEEVVSGPRLAELLPAAWKADPLDTLKIIFNARSIHLGKSSRVSFYRCAGWLAQNHPAT 196 [Nectria] haema...
EMT60789     146 TENGDLAYRSSQDALVDLFQELEEVVSGPHLKDLLTRAWQENPLATLRIIFNARSIHLGKSSRTVFYRCAGWLAQNHPLT 225 Fusarium oxyspo...
EGR51124      92 TENADVAFRSTENALVDLFYEMEEVVSGERLKELLDAAWAVHPLITLKTIFNARSIHLGKSSKHVFYRAAGWLAKNHPLT 171 Trichoderma ree...
XP_013948585  90 TENSDVAFRSTKSPVVDLFYELEDVVSGPRLKELLDAAWAEQPLATLKIIFNARSIHLGKSSKHVFYRAAGWLAEHHPLT 169 Trichoderma atr...
EHK18098     174 LVGNLRWLSRPIIEKKarkegendsdegfik--------------------vekregdenavdryDVRYGVSHGYWKDLL 233 Trichoderma vir...
EJT75764     205 LAVNLRWLSRPVIPKKaekegdvdkpvlv-----------------------daaeadehdpahhDVRNGVSHGYWKDLL 261 Gaeumannomyces ...
EMR63341     236 LISNLRWLTRPIIEKKvektdedgdtvlv------------------------eaekdednitrfDVKNGVSHGYWKDLL 291 Eutypa lata UCREL1
XP_001903562 176 LVSNIHLLSSPVIPKPtsakkqeseavkedl-------------------vmveaetteedapglDVVTGMSHGYWKDLL 236 Podospora anser...
EON67117     195 ALLNLKWLARPVIEKKvvkkedadldaii-----------------------vnapedvegdgqwLVRNGVSHGYWKDLL 251 Coniosporium ap...
XP_007672588  83 LLVNLPWLVRPLIPKKapkaedaerkkgtgevgddfelidsgpepesqpetkrlklddeaklnefDIKYGVAHGYWKDLL 162 Baudoinia panam...
XP_003046418 197 LVANLQWLSRPVIEKKakkeseddaviv--------------------------dvkdeddptkyDVKHGVAHGYWKDLP 250 [Nectria] haema...
EMT60789     226 LVANLCWLSRPVINKKaekkedddlvlv--------------------------eeendddstkfDVKNGVAHGYWKDLL 279 Fusarium oxyspo...
EGR51124     172 LIGNLRWLSRPVIEKKkkvvrskedeadegfv------------------kiekregdedavdrfDVRYGVSHGYWKDLL 233 Trichoderma ree...
XP_013948585 170 LVGNLRWLSRPVIEKKvrkegekdadeefvk--------------------vekrdgvenavdrfDVRYGVSHGYWKDLL 229 Trichoderma atr...
EHK18098     234 NILVLAMEKKLdVLENPKDVLNVENEDIKNAVLARrqkkrggvspstrgargargrggratisarraaaieaarqrakak 313 Trichoderma vir...
EJT75764     262 NILALAANGSLnPLSDPKALLNLDQRGDREVSKTS--------------------------------------------- 296 Gaeumannomyces ...
EMR63341     292 NILALSVNGRLdVLARPEDILNVEELKGQGPKVD---------------------------------------------- 325 Eutypa lata UCREL1
XP_001903562 237 NLLALAANGKLnVLASPRDVLNIKCETKPSVRYD---------------------------------------------- 270 Podospora anser...
EON67117     252 NILVLAVNKHLgVLKDPALVLNMKNKQPKKRKFNSt-------------------------------------------- 287 Coniosporium ap...
XP_007672588 163 NILVLAVNGELkVDGTPSKVLNVKAPEPYKREWTKggn------------------------------------------ 200 Baudoinia panam...
XP_003046418 251 NILALAVNKKLdGLSDPKSVLNSKNPGIIRGKSITktr------------------------------------------ 288 [Nectria] haema...
EMT60789     280 NILAIAANDKLtVVDDPKEVLNIENPGIIRGKSINkprh----------------------------------------- 318 Fusarium oxyspo...
EGR51124     234 NILVLGMEKKLdVLEDPRSVLNTEEQKREEEAAR---------------------------------------------- 267 Trichoderma ree...
XP_013948585 230 NILALAAEKKLkVLENPKDVLNVEDVAIKSKTISRrrqkqnatgsgrtrkrivktnkg---------------------- 287 Trichoderma atr...
EHK18098     314 emrgkpnrhvleeptvrignpefaqqvaafeeaqaraeaalhraekrelkatqtthaleekmvhIGNLKLARHRERDDRH 393 Trichoderma vir...
EJT75764     297 ----------------------------------------------------------------PDDAKVKRHAAREDRH 312 Gaeumannomyces ...
EMR63341     326 ----------------------------------------------------------------KGATKVRRHEVRSERH 341 Eutypa lata UCREL1
XP_001903562 271 ----------------------------------------------------------------QEKAKEQRAKIRDARH 286 Podospora anser...
EON67117     288 ----------------------------------------------------------------KDEVKENRHAQEQERH 303 Coniosporium ap...
XP_007672588 201 -----------------------------------------------------------------------kkLRTAKRH 209 Baudoinia panam...
XP_003046418 289 ------------------------------------------------------------------grGEFRRQTRDNRY 302 [Nectria] haema...
EMT60789     319 ------------------------------------------------------------qqnrKVDPKELRRETRENRH 338 Fusarium oxyspo...
EGR51124     268 ----------------------------------------------------------------VEKAKLERHRERDSRH 283 Trichoderma ree...
XP_013948585 288 ------------------------------------------kvekkeqelaeiehaleektahIGNPSVARHAARDSRH 325 Trichoderma atr...
EHK18098     394 EASMDRFNTNAVYRTLHVTVARLFAEQLHSDLAALRDSDPKAKRGISLCAKWAPSHGNFHDRHTCIISSIAEILYPREsL 473 Trichoderma vir...
EJT75764     313 KKVLLKFGNEPVYRALHMSVARLFAAQLKEDLRKLRSGDAKEMRQISLCAKWAPSMARFHDKHTFVVSTLAELLSPPTaG 392 Gaeumannomyces ...
EMR63341     342 KRAVERFESDPVHRALHITVARLFAEQLKSDVSLLHSDDPKAKRRISLCAKWAPSHDRFHDRHTFIVSTIAEILDPMVg- 420 Eutypa lata UCREL1
XP_001903562 287 HQACTLLESDATYRALHLTVSRLFAEQLKKDIALLRDGDNKAKKQISLCGKWAPSTDRFHDKHTFVVSTIAELMYPALmF 366 Podospora anser...
EON67117     304 QKFLDRFDHDGFYNVLHLNVARLFAEQLRADMKLLDSGDKKALRRISLCAKWAPSLERFHDKHTFIASTIAEMLYPQTeL 383 Coniosporium ap...
XP_007672588 210 DYAVKKLDSDHVYKALHLSVARLFAAQLKLDTSRLNSGDRAEIKKITLAGKWAPSPEEMHDQHTCIVSSIAEALYTFDqI 289 Baudoinia panam...
XP_003046418 303 EAAVKAFNTDPVYRALHLTIARLFAEQLEKDLCILRGVDAKAKRTISLCGKWAPSHDHFHDRHTFIISTIAEILYPRDsI 382 [Nectria] haema...
EMT60789     339 ETAQVLFKTDPVYRALHLTIARLFAEQLKKDIQALRGDD-KAKRSISLCGKWAPSPDHFHDRHTFIVSTIAEIMYPRAsI 417 Fusarium oxyspo...
EGR51124     284 EAAMERFNSDPVYRALHVTVARLFAEQLQSDLAALGHADPRARKNISLCAKWAPSHGNFHDRHTSIISSIAEIMYPREsL 363 Trichoderma ree...
XP_013948585 326 EALKDLFDANAFYRTLHITVARLFAEQLHADLEALRSSDPKAKRGISLCAKWAPSHGNFHDRHTCVISSIAEILYPREsL 405 Trichoderma atr...
EHK18098     474 SSav----saSDNREVYLRHAREQYRKDV-SALRKHLEVVERNISASTFEKIKYERVPSVAMKNYTRLFISKDFDRFQDY 548 Trichoderma vir...
EJT75764     393 DQ--------AEDRESFLRHARDSYRKDM-TALRKQLEVVERDVTAQTFDNIKYDRVPSIAMQNYAPVFAAKDTERFDEY 463 Gaeumannomyces ...
EMR63341     421 ----------EMDRELYLRHARESYRKDI-SSLRHHLGVIERNLSANTLDKIKYERVPSIAMQNYVPIFDKKDKDRFDQY 489 Eutypa lata UCREL1
XP_001903562 367 SSdi------agNRELYLRHAREAYRKDI-SALRKHLDIVERKLSAKTLDKIKYDRVPSVAMNNYTPIFAAKDETRFMKY 439 Podospora anser...
EON67117     384 DPtl-------tDREMYLKHAREAYRSRTlAPLRKALAVVERDITAENFSAIKYERVPSLAMDRYKLLFAQKDFDHFSAY 456 Coniosporium ap...
XP_007672588 290 CPtt----vkAGDRTTYLKYAREAYRFKTlSPLRKHLQIVERPISAKAFGEIKYDQVPSLAMARYSSLFAKKDSERFDKY 365 Baudoinia panam...
XP_003046418 383 QDnrls---ptdDRETYLRFAREEYRKDT-SALRKHLEVVERDITLQKFDNIKYDRVPSLAMSQYSKLFIEKDMDHFGAY 458 [Nectria] haema...
EMT60789     418 YHpils---prdDHEKYLRFAREQYRKDT-SALRKQLEIVERDISVKKYENIKYDRVPSLAMNQYSKLFIENDAERFGKY 493 Fusarium oxyspo...
EGR51124     364 GSvvvvssapDVSREVYLRYAREQYRKDV-SALRKYLEVVERDISAQTFDKIKYDRVPSIAMRNYTKLFVQKDLDRFEEY 442 Trichoderma ree...
XP_013948585 406 GSav----saSTSREVYLRHAREQYRKDV-SALRKHLEVVELDIGANTFDKIKYERVPSIAMKNYTNLFIKKDLDHFRGY 480 Trichoderma atr...
EHK18098     549 ITKVAGGKASISGAVLLPSTLVQSVstaiapa-------sdlkhlsQQELINRTVKEIEAKVADGQWKTLVQRIKDSGTL 621 Trichoderma vir...
EJT75764     464 VTKVAGGKAKISGAVLLPSTLVSKLrssrlra--------kgaktgASTAVEAKIAELEAKVLDGQWATLVQRIRDSGTL 535 Gaeumannomyces ...
EMR63341     490 IDQVGQGKAKISGATLLPSTLIKTMrcp----------------spG--------DKMSKRVADAQWRTLVQRIKDSGTL 545 Eutypa lata UCREL1
XP_001903562 440 LDDVSTGKTQISGATLLPSTLIKAAreasdrstys-fgsqtkkkrtLKEMKADVVGAATSKVIDGQWKTLVQRIKDSGTL 518 Podospora anser...
EON67117     457 LEDVTSGKARISGAVLTPATLVHQAtqlylppeppsdasdpdarltTKQRLVAKLNRVTAQTLNGQWNAIVQRMRDSGTL 536 Coniosporium ap...
XP_007672588 366 ITDVAEGRSQISGATLLPSTIVKDArhsfgap-------gasksksINALVGAKLNQMKMKVSNGQWNTLVQRIRDNGTL 438 Baudoinia panam...
XP_003046418 459 IDKVAEGKANISGATLLPSTLIQKVrggnsg----------sgnnsARDLVDRKVHEIEAKVVDGQWKTLVQRIKDSGTL 528 [Nectria] haema...
EMT60789     494 LDKVAEGKANISGATLLPSTLIQKVrmggs-----------sdrsgANKLLDQKVAEIEAKVLDGQWNTLVKRIKDSGTM 562 Fusarium oxyspo...
EGR51124     443 LGKVAEGKANISGAVLMPSTMVRSAsehipsa-------silaslrPQQIIDAKIMELEAKVVDSQWKTLVQRIKDSGTL 515 Trichoderma ree...
XP_013948585 481 INKVAEGKARISGAVLMPSTLVKAAsgripyan------rdlegltADEVVDRTVKEIEAKAVNGQWKALVQRIKDSGTL 554 Trichoderma atr...
EHK18098     622 SSCIAICDVSGSMSSPVFKDGTTPMHSAVGLSLLVAEVTEQPFGGKFITFHSHPEMKSVDLS---KTLHEKVRDIMGSSW 698 Trichoderma vir...
EJT75764     536 SSSLAVCDVSGSMTHPTRSDGTTPMDSAIGLSLLVAEVAAPPFAGAFITFSENPRVQRVDVT---DTFRQKVTSLRGSDW 612 Gaeumannomyces ...
EMR63341     546 ESSIAVCDVSGSMSYPMFPDGTCPMDSSIGLSLLLAEVTAPPFGGSFITFSSKPQVQTFDVA---LPLQEKYNLLSKAEW 622 Eutypa lata UCREL1
XP_001903562 519 ESCIAVCDVSGSMSSPVFQDGTTPMDSSIGLSLLVAEVTKPPFGGAFITFSTDPKVEKVDLS---EGLGEKYNKMARADW 595 Podospora anser...
EON67117     537 ENSIAVADVSGSMTWPTFADGTRPMDSAIGLALLVAELTAPPFGGAFITFSSTPEIVRVDRPeggRDFVQRVHATANASW 616 Coniosporium ap...
XP_007672588 439 SSSIAVCDVSGSMSYPVFADGTCPMDSAIGLSLLLAEVTQPPFGGACITFSANPKVVRVGGPddkRTFEEKVKYMCGTEW 518 Baudoinia panam...
XP_003046418 529 ESCIAVCDVSGSMTYPNFPDNTTPMDSAIGLSLLIAEVAKPPFSGAFITFSASPTVEQVDLT---KPLGDKYRNMLSSQW 605 [Nectria] haema...
EMT60789     563 DSCIAVCDVSGSMNSPVFKDKTTPIDSAIGLSLLLAEVAKPPFAGTFITFSENPRVEEVDLS---KTLREKYWAMHRSEW 639 Fusarium oxyspo...
EGR51124     516 SSCIAVCDVSASMTGPVFKDGTTPMHSAVGLSLLVAEVTEPPFGGHFITFSSRPQLQAIDAR---LSLGDKIRNMMGADW 592 Trichoderma ree...
XP_013948585 555 SSCIAVCDVSGSMESPRFRDKTTPMDSAVGLSLLVAEVTEPPFGGNFILFHSHPRMISIDTA---QTLSEKVAAIKQSDW 631 Trichoderma atr...
EHK18098     699 GMNTNFVAVFENLILPMAIEKGLKQEDMVKRVFVFSDMQFDAAqTGydyye----------------------------- 749 Trichoderma vir...
EJT75764     613 GMSTNFVAVFEELILPLAIKNNIRPEDMVKRVFVFSDMQFNEAeSD---------------------------------- 658 Gaeumannomyces ...
EMR63341     623 DMTTDFVAVFEDLILPMATRNELKPEDMVKRIFVFSDMQFNKAeAA---------------------------------- 668 Eutypa lata UCREL1
XP_001903562 596 GASTDFCAVFSRLILPMAIKNAVKPEDMVKRVFVFSDMHFNSA-QY---------------------------------- 640 Podospora anser...
EON67117     617 GMSTDFVAVFEKLILPLAIENNVPAEQMVKRVFVFSDMHFDAAqPPeaslsaprspssvpsvplpssptspmspglmsss 696 Coniosporium ap...
XP_007672588 519 GMNTDFVAVFEQLILPMALEHELKPEEMVKQVFVFSDMQFDQA-TAnsf------------------------------- 566 Baudoinia panam...
XP_003046418 606 GMNTNFVAVFEDLILPMAIRNNLKQEDMVKRVFVFSDMQFDAAcGNesyswd---------------------------- 657 [Nectria] haema...
EMT60789     640 GMSTNFVSVFEDLILPMALQNKLKQEDMIKRVFVFSDMQFNDA-SSsdsryyq--------------------------- 691 Fusarium oxyspo...
EGR51124     593 AMNTNFVAVFEDLILPTAVEKGLKREEMLKRVFVFSDMQFDAAeRGyyghh----------------------------- 643 Trichoderma ree...
XP_013948585 632 GANTDFVAVFEKLILPTAIENNLKQEDMVKRVFVFSDMQFDQA-KGyqht------------------------------ 680 Trichoderma atr...
EHK18098     750 -------------ppesRVR-WS-SSYERIKKKYEEHGYELPELVFWNLAGGragyhg---------tggdetAPKPVLA 805 Trichoderma vir...
EJT75764     659 -----------------QDR-WS-TSFERISTRYRAAGYEMPELVFWNLAGGragvtg----------vgdptAPKPVTA 709 Gaeumannomyces ...
EMR63341     669 -----------------QDR-WT-TSFERIKKKFADAGYEMPQMMFWNLAGGrggyggfpvtsswgmdvpepvVPKPVTV 729 Eutypa lata UCREL1
XP_001903562 641 -----------------GVGqWS-SSFERIQQDFKDAGYEMPELVFWNLAGGrdgys-----------gsydiAPKPVAA 691 Podospora anser...
EON67117     697 sppfppspslqstapeqTSErWS-TSFERIQKKFKDAGYEMPELVYWNLAGArpda-------------veqgAPMPVKA 762 Coniosporium ap...
XP_007672588 567 ---------------mrDSSaWS-TSYKRIQRGFKKHGYQMPRLIFWNLAgd-------------------etAPKPVTA 611 Baudoinia panam...
XP_003046418 658 ------------eqpkkPAE-WT-TSFERIKSKYQDAGYEMPELVFWNLAGGragysg---------gmgdttAPKPVTA 714 [Nectria] haema...
EMT60789     692 -----------gwaserPSS-WS-TSFERIKAKFEKAGYELPELVFWNLAGGragytg---------sggdptAPKPVKA 749 Fusarium oxyspo...
EGR51124     644 -------------gdkdKIT-WA-SSYERIKAKYEEHGYEMPELVFWNLAGGragygggg-----gggqgdevAPKPVLA 703 Trichoderma ree...
XP_013948585 681 -------------ydqkPEP-WSaSSYERIKKKYEEHGYEMPELVFWNLAGGragysag--------gggdetAPKPVLA 738 Trichoderma atr...
EHK18098     806 GEAGTALVSGYSQGMLKVFMDNGMFDVEEEeeeeeeeskkveVQDEdededmv----------eitakqPAKKAKTNPLA 875 Trichoderma vir...
EJT75764     710 DTEGTALVSGYSQGMLKVFLDGGGFEDPEEseeeeeeepvvvAEDVeeepvvitkd----gedietleqPAKKRKKDPLQ 785 Gaeumannomyces ...
EMR63341     730 EEHNTATVSGYSQGMLKVFLDNGSFEEREEeqeeeskaeeikEVGSgenag--------------kessPTKRRKIDPLS 795 Eutypa lata UCREL1
XP_001903562 692 DQVGTALVSGYSQGMLKVFLGGAGFDEIKEede------emaVVVTkdgee--------------vtvePEAKHRKDPYD 751 Podospora anser...
EON67117     763 DEPGCALVSGYSQAMMKMFLEGGGFEDPDEgdkmeviektvvLDEEgneg----------------eevVTREEKKDPMS 826 Coniosporium ap...
XP_007672588 612 AEVGTALVSGYSQGQLKMFLDNGQFEDPDAeet-------veDMDVeegg---------------evvvEKKVKKQDPLG 669 Baudoinia panam...
XP_003046418 715 EEEGTCLVSGYSQGMLKVFLDGGGFEEPEEddee----eevvVDKDedgna--------------tekpTKKKAKMDPLK 776 [Nectria] haema...
EMT60789     750 DEDGTCLVSGYSQGLLKVFLEGGGFEEEDEev---------vVEKDekgn----------------vtqKTKKVKMTPLK 804 Fusarium oxyspo...
EGR51124     704 GEKGTALVSGYSQGMLKVFMDNGMFDEAEE-------------EEDgdggevveg-----dmvevaapgEAKKGKTDPLA 765 Trichoderma ree...
XP_013948585 739 EEMGTAMVSGYSQGMLKVFMDNGMFDEEEEeeeeeeeeeeeeEEEEeeeeeddfekmdeegneekpekvAKKKEKVNPLM 818 Trichoderma atr...
EHK18098     876 VVKKAI 881 Trichoderma virens Gv29-8
EJT75764     786 VVKRAV 791 Gaeumannomyces tritici R3-111a-1
EMR63341     796 TVKKAV 801 Eutypa lata UCREL1
XP_001903562 752 QVKQAI 757 Podospora anserina S mat+
EON67117     827 YVRKGV 832 Coniosporium apollinis CBS 100218
XP_007672588 670 VVRKAI 675 Baudoinia panamericana UAMH 10762
XP_003046418 777 VVKKAI 782 [Nectria] haematococca mpVI 77-13-4
EMT60789     805 IVQKAI 810 Fusarium oxysporum f. sp. cubense race 4
EGR51124     766 VLKKAV 771 Trichoderma reesei QM6a
XP_013948585 819 LVRKAV 824 Trichoderma atroviride IMI 206040
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap