5M0I


Conserved Protein Domain Family
She2p

?
pfam11435: She2p 
Click on image for an interactive view with Cn3D
RNA binding protein She2p
She2p is a RNA binding protein which binds to RNA via a helical hairpin. The protein is required for the actin dependent transport of ASH1 mRNA in yeast, a form of mRNP translocation. ASH1 mRNP requires recognition of zip code elements by the RNA binding protein She2p. She2p contains a globular domain consisting of a bundle of five alpha-helices.
Statistics
?
PSSM-Id: 402856
View PSSM: pfam11435
Aligned: 17 rows
Threshold Bit Score: 271.07
Threshold Setting Gi: 357524811
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5M0I_C        18 EQILALLSRYLSSYIHVLNKFISHLRRVATLRFERTTLIKFVKKLRFYNDSV-------LSYNASEFINegknelDPEAD 90  Saccharomyces c...
Q6FMJ2        20 TKISSVFSAYLSANIHILNKYINYLRRVTSLKNERSIMIKIVKKLRFFNDTL-------LSTDLAQLQTt----yEGEEP 88  [Candida] glabr...
XP_003678756  12 AETSELFSSYISSYVHFLNKFIGHLRRVASLRYERTTLIKFVKKLRFLNESL-------TSYDVSSNMA------KFNEK 78  Torulaspora del...
C5DGE2        17 qlaIQSYSNYLSSYIDALNKYISHQRRVSTLRFERATLIKYVKKLRFFNEEL-------MSMDMVQQYR--------GGN 81  Lachancea therm...
Q758R0        58 EEVIQEQANYISRYIDFLNKYINYQRKVSTLRFERATLIKYVKKLRFLNDFL-------YTYNADVNMI---------TE 121 Eremothecium go...
CCE64076      53 LEAIHIFIKYISDNINLLNNYILLMKKVTSLNYERTCLIKFVKKLRFYNETLrnshlfnMESEEDREEKedelnfKFENV 132 Tetrapisispora ...
A7TDZ7        20 EQIKEVFSTYISSYVHILNKFIGILRKVSTMRFERSTLIKYVKKLRFFNETL-------LNYEFPLLTS-------SDIT 85  Vanderwaltozyma...
XP_003686560  24 MEIKDLFSVYISSYVHVLNKFIGILRKISTLRFERSTLIKYVKKLRFYNDRL-------SNFEFSDPAN------AECSV 90  Tetrapisispora ...
CCH62725     196 sdnVRVFVHYIDCYVGFLNKYIGLLRRQQCLRFERSVVIKFVKKMRFVSNSL-------VEFRTKLDTNq-----LDESI 263 Tetrapisispora ...
XP_001642607  13 KELIPLFKKYISVNVQLLNDYILVLKRASCLKNERIALIKFVKKLRFFSQSL-------HRTMFFDDLH------SRKDD 79  Vanderwaltozyma...
5M0I_C        91 SFDKVILPIASMFVKSVETFDLLNYYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFVKFSQWMIE-SLRIGSNLL 169 Saccharomyces c...
Q6FMJ2        89 ELALNIQTFASYLVKCLETIDLLNYFLLKPLQKELIAKTLNFDLVFPEDITDTVEDTYNHFVKFTQWSIE-SLSIDDPLL 167 [Candida] glabr...
XP_003678756  79 NFGVAVIPLASFYLKCIELFDMLDFYLTKPLQNEIVSKTLNKDLCLSEECIIAIDDTHNHFVKFTQWMVE-SLENADPLL 157 Torulaspora del...
C5DGE2        82 LIKTAVCSLASFFIRCLEVMDLLNYYLTQSLKNETISKTLNRDLVVSEDCVVFLESTYRHYVKFTQWMLE-ALDIHDATL 160 Lachancea therm...
Q758R0       122 PLQKLVRPLGSFFIRYLEIIDLLNYYLTQSLRNETISKTLNQDLVLSQECIAMADKTYRVYVKFVQWFIEsSSSVTTGDL 201 Eremothecium go...
CCE64076     133 DIINRVILLNSIFIKNLETLDLLNFQLTRSLQNEIWMKTLNEKLLIPEKNVAMIEDVYNHYIKFIQWLSE-TIGMHDSTG 211 Tetrapisispora ...
A7TDZ7        86 TVRLQVKAIGSFFIKFLEMQDILNYYLTQSVQNEVISKTLNYKLNFPDAAIERIEDSYNHFVKFTQWMMQ-SLLIDDELS 164 Vanderwaltozyma...
XP_003686560  91 PVESVVREISAFYLKVLETIDILNYYLTRSLQSEIVSKTLNFNLTLPDDTISRIEESYNCFIKFVQWMME-SISINDELL 169 Tetrapisispora ...
CCH62725     264 DSEQLIVLIGSQYLKFIEILDLLTYYLTQPLSNETIIKTLNSNYIIPPECVTVFEDTNNHILKFIQWFLE-SININDSFL 342 Tetrapisispora ...
XP_001642607  80 SLLHCVGIIGAYFVKCLETLDLLYFFLTKPLQTEILSKTLNEKLILKDSTVVNLEDTFSYFVKFTQWLLE-SLGLNDPLY 158 Vanderwaltozyma...
5M0I_C       170 DLEVVQFAIKSADED-------GTNIG-ETDNIFLQEILPVNSEEEFQTLSAAWHSI-----LDGK 222 Saccharomyces cerevisiae RM11-1a
Q6FMJ2       168 DIEVVQFSLRCAEED-------QSYAE-ETDNIFLQEVLPVKDSQEYETLTLQWLDV-----LNGK 220 [Candida] glabrata CBS 138
XP_003678756 158 QIEVVQFARKCAVAD-------NVDIE-ETSDILLQEVEPVADAAEYEELSSKWASV-----LEAK 210 Torulaspora delbrueckii
C5DGE2       161 TVEVLQFARKCAKED-------GLDLE-ETDDILLQEVGVVSSASEYQELLDEWCLV-----LSEQ 213 Lachancea thermotolerans CBS ...
Q758R0       202 TMEIVQFTRKCAVED-------GIDLG-ETDDVLLQEVQLVTSSEEFEDLLEKWQQV-----LHFQ 254 Eremothecium gossypii ATCC 10895
CCE64076     212 QLEVITQTIRYAQEDpsqpfpnSIHDEvETENIFLQTVIPSKNEEEYIQTLKEWLNI-----LTAK 272 Tetrapisispora phaffii CBS 4417
A7TDZ7       165 QIEVIQFSIKCAVED-------NVDLT-QTTNIFLQEVAPVESLAEYMELSEEWVAI-----LKDL 217 Vanderwaltozyma polyspora DSM...
XP_003686560 170 QIEIIQFSLKCAIED-------NVDLE-ETDNIFLTEVTPVEDIEEYETLALQWSEV-----LSGS 222 Tetrapisispora phaffii CBS 4417
CCH62725     343 KSEVIQFALKWARED-------EVDLE-FTKNMFLQEIIQVDDIEEYEELLIDWTNI-----LVEK 395 Tetrapisispora blattae CBS 6284
XP_001642607 159 QIEIIHFSVKYAVEE-------GIDID-DTEDILPFRC----------NGNPKWRMIsikmlLNGK 206 Vanderwaltozyma polyspora DSM...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap