4HEA


Conserved Protein Domain Family
DUF3197

?
pfam11432: DUF3197 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF3197)
This bacterial family of proteins has no known function.
Statistics
?
PSSM-Id: 371529
View PSSM: pfam11432
Aligned: 9 rows
Threshold Bit Score: 138.292
Threshold Setting Gi: 81551555
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4HEA_W             18 KAALGGLKLSEAKVYLITDWQDKRDQARYALLLH----TGKKDLLVPDAFGPAF-PGGEEALSELVGLLLAQGARrFYEA 92  Thermus th...
WP_015236691       21 ERTFADIDLTGGAITFVTESQGQRANARYGAVIE----AAGKTYVIVEAFGGQFgPGGVEGLQALARWAQSSGIQtYRES 96  Deinococcu...
WP_012694511       21 LSGAQTLNLNGGRLLLVTDWQGHRPLARYGAVLLp---ASGEPLVLTATFGPRFgPTGAQALAELVTWAQEQGLV-LRET 96  Deinococcu...
WP_013458070       18 KPRLKKLHFPSLKVVLVTDRQGRRERARYRVFLV----GGKHALLTEDAFGPAYgEAGERALAELVQLLRKGGAYnFKEA 93  Oceanither...
WP_013158817       18 MEALKGARFPDLIVTFVTDWQDQRKKARYAVFVR----GGKHPLLTMDAFGPAFgPEGDRALVELVQWLQDKGVRkWYES 93  Meiothermu...
pacbio:K649_00320  18 KEALKGVSFPEALAIYITDWQDQRAQARFALFVR----QGKHRVLSRDAFGPRFgLEGDAALKDLTLWLIERGVTdFKEA 93  Meiothermu...
Q9RVX1             25 QARLNDADLTGARLILITDRQGERPWAGYAALVTlgrgAAEEAILSAPAFGPRYgAAGAAALAELVRWADSAGIR-PTET 103 Deinococcu...
WP_013704339       18 QDALKNTHFPSLIVTLVTDWQDQRDRARYALFIR----GAKTPILTEDAFGPAFgEPGRRALAEAVAWLEQKGVRkFYEA 93  Marinither...
jgi:Dgeo_2021       5 LAHLEKIEAPEGRLVLITDREDERLQARYGALLT----FGGEALVTAPAFGPAYgPEGARALAELTRWAQERGWP-VRET 79  Deinococcu...
4HEA_W             93 VVSPGEMTALLDLPPEELLKRVMAIANPTDPGIY 126 Thermus thermophilus HB8
WP_015236691       97 ILSTYDFNRVLREPDEGEIQQLIVSANPSDVNIY 130 Deinococcus peraridilitoris
WP_012694511       97 VLSPSAFMQVLEEPDHEEIRHLVAASNPTDPGIY 130 Deinococcus deserti
WP_013458070       94 VLPPDVYAALDAMDEAAARERLLANANPADPRLY 127 Oceanithermus profundus
WP_013158817       94 VIPPSEYAALFEIDPDDVYRQLAANANPSDPALY 127 Meiothermus silvanus
pacbio:K649_00320  94 VVAPSEFAALFELEAEEAQKLIMASANPTDPMLY 127 Meiothermus ruber DSM 1279
Q9RVX1            104 ILGSGDFQRVLAEPDAGEVAALIAATNPADPAIY 137 Deinococcus radiodurans
WP_013704339       94 VLPPSEYQGLFDLEPETAYRRLVASANPTDTAIY 127 Marinithermus hydrothermalis
jgi:Dgeo_2021      80 VLSASDFVRVLAEPDADEVRRLLAASNPSDPAIY 113 Deinococcus geothermalis DSM 11300
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap