2M67


Conserved Protein Domain Family
Transport_MerF

?
pfam11431: Transport_MerF 
Membrane transport protein MerF
The mercury transport membrane protein, MerF has a core helix-loop-helix domain. It has two vicinal pairs of cysteine residues which are involved in the transport of Hg(II) across the membrane and are exposed to the cytoplasm.
Statistics
?
PSSM-Id: 402855
View PSSM: pfam11431
Aligned: 11 rows
Threshold Bit Score: 50.0418
Threshold Setting Gi: 427990212
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2M67_A                          24 TPVLVILLGVVGLSALTGYLDYVLLPALAIFIGLTIYAIQRKRQA 68 
WP_013293840                    23 TPVLVLLFGAFGLAAWVGYLDYVLMPALLFFVGLIIYAVNRKSKE 67  Gallionella capsiferriformans
jgi:Nhal_1677                   23 TPVLVLLLGALGLAAWVGWLDYVLFPALAFFLGLTAYAFWRQRRS 67  Nitrosococcus halophilus Nc 4
dbos:1099484000105_PB2503_12399 41 TPILVVLLGAVGLSAVLGWIDYVLLPALALFIALTVYAVWRRQKR 85  Parvularcula bermudensis HTCC2503
WP_000654684                    24 TPVLVILLGVVGLSALTGYLDYVLLPALAIFIGLTIYAIQRKRQA 68  Proteobacteria
CGS-ASRI:BpOF4_20579            23 TPILVILLGAVGLGAITGYLDYVLIPVLAVFLGLTFYAYSKYEKS 67  Bacillus pseudofirmus OF4
jgi:Ple7327_0233                23 TPILVILLEVVGLSAVVGYLDYVLLPALGILVALTVLFYFRYRKS 67  Pleurocapsa sp. PCC 7327
WP_015195744                    24 TPILVILLGAIGLSALVGYLDYVLLPALLIMLALTVLSYSRYRRc 68  Stanieria cyanosphaera
jgi:Pse7367_2203                23 TPILVLFIGLLGWGAFAGYLDYILLPLLLGMILLTTFSYIRYRQH 67  Pseudanabaena sp. PCC 7367
jgi:Glo7428_5118                23 TPVLVIGLGVIGLSAWIGYLDYVLLPTLGAMVGLTIVSYWRYRh- 66  Gloeocapsa sp. PCC 7428
CASKLGSI:MRBBS_0155             24 TPILVILLGTLGLAALTGYLDYVLLPALAFFIGLTCYALWRKKKH 68  Marinobacter sp. BSs20148
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap