Conserved Protein Domain Family
Tn7_TnsC_Int

?
pfam11426: Tn7_TnsC_Int 
Tn7 transposition regulator TnsC
TnsC is a molecular switch that regulates transposition and interacts with TnsA which is a component of the transposase. The two proteins interact via the residues 504-555 on TnsC. The TnsA/TnsC interaction is very important in Tn7 transposition.
Statistics
?
PSSM-Id: 371524
View PSSM: pfam11426
Aligned: 5 rows
Threshold Bit Score: 76.3766
Threshold Setting Gi: 81363261
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Tola_0305             508 SKDWDTLQTDSLRYMYSQNSApTAIYNEMVKAGYILKLSDILQKA 552 Tolumonas auensis DSM 9187
WP_013515442              502 RKDWHSLGSEDLRFVFSQTDS-KDMYEHLKQNSMIFDMEDWLRKP 545 Pseudodesulfovibrio aespoeensis
Q5QZG6                    512 SKEWHTLPSDDLRFKYSQRKS--QFYGELAVGRDIFDMEARLKQV 554 Idiomarina loihiensis
WP_014003726              506 KEKWHALDSHDLRFLFSQASSeEDVYKSLGQKGLFFDTESWVDSY 550 Acidithiobacillus caldus
BOB002_L21SP2:L21SP2_2663 507 PKDWHTLETDDLRFVSSQADNtDEFVEILKSSGVMFDTDAWIDTy 551 Salinispira pacifica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap