1NO4


Conserved Protein Domain Family
Scaffolding_pro

?
pfam11418: Scaffolding_pro 
Click on image for an interactive view with Cn3D
Phi29 scaffolding protein
This protein is also referred to as gp7. The protein contains a DNA-binding function and may halve a role in mediating the structural transition from prohead to mature virus and also scaffold release.Gp7 is arranged within the capsid as a series of concentric shells.
Statistics
?
PSSM-Id: 402846
View PSSM: pfam11418
Aligned: 2 rows
Threshold Bit Score: 139.875
Threshold Setting Gi: 33357474
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1NO4_C     1 PLKPEEHEDILNKLLDPELAQSERTEALQQLRVNYGSFVSEYNDLTKSHEKLAAEKDDLIVSNSKLFRQIGL---TEKQE 77  Bacillus virus phi29
KNC25438   1 MLTPEQHEAILNDLMNPETSIETRTQHLMTLRDDYVEVHVNHSTQTQQIDAFKVEVADLQASNSKLFRKIGIdggTEEQK 80  Australian sheep bl...
1NO4_C    78 EDHKKADISETITIeDLEAK 97  Bacillus virus phi29
KNC25438  81 KNENQQSFSESVTL-DLLFK 99  Australian sheep blowfly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap