1M5I


Conserved Protein Domain Family
Suppressor_APC

?
pfam11414: Suppressor_APC 
Adenomatous polyposis coli tumor suppressor protein
The tumor suppressor protein, APC, has a nuclear export activity as well as many different intracellular functions. The structure consists of three alpha-helices forming two separate antiparallel coiled coils.
Statistics
?
PSSM-Id: 402843
View PSSM: pfam11414
Aligned: 30 rows
Threshold Bit Score: 60.3267
Threshold Setting Gi: 677992323
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1M5I_A          2 SRESTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPLTEN--FSLQTDM-TRRQLEYEARQIRVAMEEQ 78  
EKC20269      320 DYNMIKRMKQLEQEKDSLLKGLEMVDQAREWYHRQVLGVEDKQKYIGHTSY--NDYNLEA-NQERMNFQNARIMEVNQQL 396  Pacific oyster
XP_003728145  174 dynmLKRMKQLEQERDIFLQGLEALELARDWYRQQLASIRDRQDRINKAQV---DFTEDIdHQDMVVYRTTRITELNRQL 250  purple sea ur...
EFX73731      309 DQSMLRRIHILEQERQVLTSGMQALDKARDWFNSQLIDVNERIKSFGKSSIgsSDYSTDA-ASERLGFKISRIEEVSRQL 387  common water ...
XP_009075736  102 sRESTGYLEELEKERSLLLAELEKEEKEKDWYYAQLQNLTKRIDSLPLTEN--FSLQTDM-TRRQLEYEARQIRAAMEEQ 178  rifleman
ELK19314      124 SRATIRLLEELDRERCFLLNEIEKEEKEKLWYYSQLQGLSKRLDELPHVETq-FSMQMDL-IRQQLEFEAQHIRSLMEER 201  black flying fox
XP_015220786  189 grvtAQHLEDLCKERTLLLSEIEKEERERRWYYSQLQGLSQRLAELPRVET--FSMQMDL-IRQQLEFEAQQLRSVMEER 265  spotted gar
XP_015781886  451 DINTIKRLQQYEQEKEILLQGLEMIERGRDWYIKSINTIQNKIRFIGQTMVnqGDYSLDA-NQERINFQAARILTVNQHL 529  two-spotted s...
XP_019201773  182 grvidHHLDELCKERDLLLGEIDREERERCWFFSQLEELSQKLAQLPRIDT--FSLQIDM-IRQKLELDAQKIRSVMEER 258  Nile tilapia
XP_002131251  555 DYNVLKLIQQLEQEKDVLLQGLDALERGRDWFQERISDVQEKQRLLSNNGM---KPTRDV-TENDATVTQSRIDNLLTKV 630  vase tunicate
1M5I_A         79 LGTC 82  
EKC20269      397 KTLI 400  Pacific oyster
XP_003728145  251 RALI 254  purple sea urchin
EFX73731      388 LVLI 391  common water flea
XP_009075736  179 LGTC 182  rifleman
ELK19314      202 FGTS 205  black flying fox
XP_015220786  266 FGTS 269  spotted gar
XP_015781886  530 AALM 533  two-spotted spider mite
XP_019201773  259 FGTS 262  Nile tilapia
XP_002131251  631 SEMS 634  vase tunicate
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap