3II6


Conserved Protein Domain Family
DNA_ligase_IV

?
pfam11411: DNA_ligase_IV 
DNA ligase IV
DNA ligase IV along with Xrcc4 functions in DNA non-homologous end joining. This process is required to mend double-strand breaks. Upon ligase binding to an Xrcc4 dimer, the helical tails unwind leading to a flat interaction surface.
Statistics
?
PSSM-Id: 402840
View PSSM: pfam11411
Aligned: 16 rows
Threshold Bit Score: 55.3588
Threshold Setting Gi: 196002285
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3II6_X        102 TKEHFAREYDCYGDSYFIDTDLN-QLKEVFSGIKN 135 
XP_001647535  737 TTAKFREEYDRHGDSFTCDATAD-SLKTVFHNIAN 770  starlet sea anemone
XP_011668210  766 mTAQFALDYDCHGDSYTQDVNEE-KLREVFANVEK 799  purple sea urchin
P49917        750 TKEHFAREYDCYGDSYFIDTDLN-QLKEVFSGIKN 783  human
XP_005507867  755 TKEHFAREYDCYGDSYTADTDVA-QLKEVFSRMKD 788  rock pigeon
EFA81882      864 TRDIFSKEIDPYGDSFTEDTDVQ-TLKDAFKQIEr 897  Heterostelium album PN500
EGG24891      816 TKQLLLQDIDRFGDSFTQDTTVD-ELLDSFNQITK 849  Cavenderia fasciculata
XP_003287084  898 TKKKFLLESDPFGDSYFNETNFS-ELKDCFNQVDK 931  Dictyostelium purpureum
Q54CR9        924 TKKRFLLDSDQFGDSYINETTEQ-SLKDSFNQIDK 957  Dictyostelium discoideum
XP_002111010  749 TAEVFAKEYDKYGDSYTKDIDNPvALKAIFDKINN 783  Trichoplax adhaerens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap