1D8B


Conserved Protein Domain Family
Helicase_Sgs1

?
pfam11408: Helicase_Sgs1 
Click on image for an interactive view with Cn3D
Sgs1 RecQ helicase
RecQ helicases unwind DNA in an ATP-dependent manner. Sgs1 has a HRDC (helicase and RNaseD C-terminal) domain which modulates the helicase function via auxiliary contacts to DNA.
Statistics
?
PSSM-Id: 151847
View PSSM: pfam11408
Aligned: 5 rows
Threshold Bit Score: 117.554
Threshold Setting Gi: 6980735
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1D8B_A          2 LNNLRMTYERLRELSLNLGNRMVPPVGNFM-PDSILKKMAAILPMNDSAFATLGTVEDKY-RRRFKYFKATIADLSKKRS 79   baker's yeast
EDO19502     1150 AKELNFAFERIKAAVVEISNRSNLPLSTYM-PVNAIKKIATFLPATEDEFVVLLGDNEQN-RRKYNDLRHVIMNLRKHKM 1227 Vanderwaltozy...
Q6FLV3       1210 VNDLKSAYDRLRNAAISWGSRMVPAVNKFM-DDNVLRRLAAILPATEEEFIGIVGNNSTD-SKKYKYFKDIFIDLRKRRI 1287 [Candida] gla...
XP_001645225 1115 LSHITVSYESLRAVSMSLGNRMNPPITNYL-PDVLIKKIAMALPETEDEFISIVGNFSNH-TRKYKYFKDTMTNLRLQRN 1192 Vanderwaltozy...
Q6CR11       1208 QAHITKCFNLLKDIAINVSSKFNFPNDTMLiSDAILWKAANKLPADQASFANLNGSNDPAlAKRFKYFSATLKKCKKERH 1287 Kluyveromyces...
1D8B_A         80 S 80   baker's yeast
EDO19502     1228 K 1228 Vanderwaltozyma polyspora DSM 70294
Q6FLV3       1288 E 1288 [Candida] glabrata
XP_001645225 1193 Q 1193 Vanderwaltozyma polyspora DSM 70294
Q6CR11       1288 H 1288 Kluyveromyces lactis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap