1CIX


Conserved Protein Domain Family
Tachystatin_A

?
pfam11406: Tachystatin_A 
Click on image for an interactive view with Cn3D
Antimicrobial peptide tachystatin A
Tachystatin A contains a cysteine-stabilized triple-stranded beta-sheet and shows features common to membrane-interactive peptides. Tachystatin A is thought to have an antimicrobial activity similar to defensins.Tachystatin A is also a chitin-binding peptide.
Statistics
?
PSSM-Id: 371512
View PSSM: pfam11406
Aligned: 2 rows
Threshold Bit Score: 65.4216
Threshold Setting Gi: 1390365093
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1CIX_A  1 YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRY 44  Tachypleus tridentatus
P0C1Z7  1 YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRF 44  Tachypleus tridentatus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap