1BI6,1BI6


Conserved Protein Domain Family
Inhibitor_I67

?
pfam11405: Inhibitor_I67 
Click on image for an interactive view with Cn3D
Bromelain inhibitor VI
Bromelain inhibitor VI is a double-chain inhibitor consisting of a 11-residue and a 41-residue chain. This protein is the 41-residue heavy chain which is joined to the 11-residue chain by disulphide bonds. The inhibitor acts to inhibit the cysteine proteinase bromelain.
Statistics
?
PSSM-Id: 402837
View PSSM: pfam11405
Aligned: 2 rows
Threshold Bit Score: 60.4029
Threshold Setting Gi: 159162116
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1BI6_H  1 EEYKCYCTDTYSDCPGFCKTCKAEFGKYICLDLISPNDCVK 41  pineapple
1BI6_H  1 EEYKCYCTDTYSDCPGFCKTCKAEFGKYICLDLISPNDCVK 41  pineapple
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap