Conserved Protein Domain Family
DUF2813

?
pfam11398: DUF2813 
Protein of unknown function (DUF2813)
This entry contains YjbD from Escherichia coli, which is annotated as a nucleotide triphosphate hydrolase.
Statistics
?
PSSM-Id: 402832
View PSSM: pfam11398
Aligned: 11 rows
Threshold Bit Score: 470.666
Threshold Setting Gi: 150840841
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6D3T4          1 MHLESIEILGFRGINRLSLTLDENNVLIGENAWGKSSLLDALSLLLAPTLPLYHFDMQDFHFTPGDENSREKHLQIIFTF 80  Pectobacterium...
WP_011768628    1 MLLDQIEVVGFRGINRLSINVKSLSAFLGENSWGKSSLFDALSLFLSGTKKAYKFTGDDFHRPSISDVSCNKLIHLVFTF 80  Psychromonas i...
Q6LIW4          1 MHLERIEVSGFRGIKRLSLSFNQLSVLIGENAWGKSSLLDALSIALAVNTEFYTFKFSDFHVDYALGHDKQTNIQIVLHW 80  Photobacterium...
Q5E0I1          1 MLLERIEVSGFRGIKRLSLSFEQLTTLIGENTWGKSSLLDALSIALPISGELHQFTLKDFHQDHSISYTQDQHIQIIITW 80  Aliivibrio fis...
Q7MEC9          1 MLLERIEISGFRGIRRLSLSFDELTTLIGENTWGKSSLLDALSVALPTDAELYQFEMSDFHVDYSISHPQTQHLQIVLCF 80  Vibrio vulnifi...
Q9KM45         12 MHLERIEIAGFRGIRRLSLTFDEITTLIGENTWGKSSLLDALSVVLPADGTLYPFTLQDFHVDYSIADAQTQNLQIILVF 91  Vibrio cholerae
P75828          1 MILERVEIVGFRGINRLSLMLEQNNVLIGENAWGKSSLLDALTLLLSPESDLYHFERDDFWFPPGDINGREHHLHIILTF 80  Escherichia co...
WP_011706231    1 MFLERIEVKGFRGINRLSLGLDNTTVLIGENAWGKSSLLRALWCLLGQDAEPYQFSSDDFHQPEDPELEPARHLQLVLTF 80  Aeromonas hydr...
jgi:Asuc_1453   1 MYLRQCDLVGFRGINRLSIHLRPHMVLIGENAWGKSSLLAALSLILNNKNRLYRFTQEDFH-----HEESTPAIMLLFTF 75  Actinobacillus...
Q9CNG5          1 MHLRQLDVLGFRGIHRLSIHFSADMVLIGENMWGKSSLLSALSLIFNPEKALYQFTLRDFHIP-AEQTEPVRHLILLFTF 79  Pasteurella mu...
Q65TG6          1 MYLRQLDISGFRGIKRLSIHLRPDMVLIGENSWGKSSLLSALSLILNVDNGLYHFVPTDFH-----RADNMKDITLLFTF 75  [Mannheimia] s...
Q6D3T4         81 CETAPG-HHLSPRYRSL--SPVWVEGNE-SLYRVFYRLEGEVDESQSVFTWRSFLDADGHP--IPLDNIDELAREIIRLH 154 Pectobacterium...
WP_011768628   81 KEQANG-ESLQRQYKSI--SAAWNLPKG-ECSYIYYQVDGSITESGNIITQRYFLDNHGQKksFKKDVLANLVNEFISFV 156 Psychromonas i...
Q6LIW4         81 KEDFAG-EHKARRYKAF--SPTWVTR-D-GIKHLYYQLSATNQ-YDKVTTERFFLDRNGTK--IECEDTDKLVKHLMILH 152 Photobacterium...
Q5E0I1         81 QTTEKN-EHKAGRYRKL--SSLWQHDANsNTQRIYYRVSATNN-DGKITSSSSFLDKDGNV--LRYHRIECLVYELIKLH 154 Aliivibrio fis...
Q7MEC9         81 RSTDRH-ETKAGRYRRL--KPVWCKDDN-GDHRIFYRISATRD-GYDITTHYAFLNNDGST--KALHHSEKIAQELMSLH 153 Vibrio vulnifi...
Q9KM45         92 AANDLH-EPKAGRYRKL--KPLWQTDEQ-GAQKIIYRISASRV-KYDISTQYAFLDLEGNS--LTLHHSEKLAQELMSLH 164 Vibrio cholerae
P75828         81 RESLPG-RHRVRRYRPL--EACWTPCTD-GYHRIFYRLEGESAEDGSVMTLRSFLDKDGHP--IDVEDINDQARHLVRLM 154 Escherichia co...
WP_011706231   81 SEHRPQmCLHSRRLARL--GAAWVKHKD-KFHRIHYRASAELQSDGTVTTTHDFLDGIGKS--LPIDDAHELVCLLITMN 155 Aeromonas hydr...
jgi:Asuc_1453  76 SERDIK-EDMDDKNQSF--QAVFVPHDD-GYDRIYLRVEGEMR-QNDVITTYSFLDELGEP--ICLENTEEVALSLICRH 148 Actinobacillus...
Q9CNG5         80 AESEKN-EDSMEYHLPYlqHHLLVDHLD-GYQRLYLRVEGQINANNEVNTTYAFLNEKGEP--IVVDDINNLVFSLIARH 155 Pasteurella mu...
Q65TG6         76 SESSIN-EEHEKFNPVY--RHIFVPHED-GFERIYLRVSGDINEQNQVQTYYSFLDQQGQP--IDVENVDFLVKELTHDH 149 [Mannheimia] s...
Q6D3T4        155 PVLRLRDArfmRRLRSGTLAATLDNSn-----eKLAQQFEQLIRELVQNPQKLTD--KELRQGLVAMQQLLEHYFSEQNA 227 Pectobacterium...
WP_011768628  157 PALRMGSErslMVTAEDTGDVEYCSKr-----aSCEARIKRIFKRLNKSSQQLSE--SEMKMGYQALVYLFDHYLLKHYG 229 Psychromonas i...
Q6LIW4        153 PVVRIRDA---RRLRDDTLEQAIQHSdeqakklRIERRLDNTCRRLITQPGHVNS--GELKSSVNALRTLVDHYFAFTPH 227 Photobacterium...
Q5E0I1        155 PVIRIRDS---RRLSPGPF-TDHVPDd------RIERRINNTCRRLLTAPGQVSS--GEIKSALQSMQSLVDHYFSFRNH 222 Aliivibrio fis...
Q7MEC9        154 PVIRLRDS---RRFPELKSDANGKNA-------RIEKRIDNTCRRLLAIPGHVNK--GEMRSSLNSMHSLVEHYFSFKSI 221 Vibrio vulnifi...
Q9KM45        165 PVIRLKDS---RRFEKSLANGNGKNA-------RVEKRISNTWRRLMATPGHVNK--GEIRSSLSAMNSLVEHYFSFKSQ 232 Vibrio cholerae
P75828        155 PVLRLRDArfmRRIRNGTVPNVPNVE-------VTARQLDFLARELSSHPQNLSD--GQIRQGLSAMVQLLEHYFSEQGA 225 Escherichia co...
WP_011706231  156 PVFRLRDA---RTARNGVETLQWGD--------LSEHRLSELADKLIDEPQRIGE--PELKEALQAVRQLMDHYFNALAP 222 Aeromonas hydr...
jgi:Asuc_1453 149 PIYRFRDA-------------------------RLNSEQD------LLNPQNMRAkyKSEDRQFQAVGLVLQHYFMS--- 194 Actinobacillus...
Q9CNG5        156 PVYRFRDA-------------------------RLNRAHHSF--RFIRTEVQ-----DETQDEIRAVSDLLCYYFL---- 199 Pasteurella mu...
Q65TG6        150 PVYRFRDA-------------------------RLNRHKAN------SQPLKYAEniDAVSRELYAVTELVKYYFVET-- 196 [Mannheimia] s...
Q6D3T4        228 TGNDRRHHRHARTHNGKSWRS--LDNINRLIAdPNSRSSRIILLELFSTLLQAKGSVV--LDPHARPLLLIEDPETRLHP 303 Pectobacterium...
WP_011768628  230 RSHFHRGDAQNDTKGQMPFSFqaLTHFNDLLK-TGHKSDRAMLLLVLGEFLEVRGEHL--LRRGATPILLLEEPENNLHP 306 Psychromonas i...
Q6LIW4        228 NRSSHFNRVHFPSYSQYGENP-----LEQLTQpQMSKQSRLVLMGLLNAYIRARGPVE--LKRISRPIMILEDPEGRLHP 300 Photobacterium...
Q5E0I1        223 RRHGQHKVRDDLFFGQKAEGV----SLNQFVNqNQSKQTKLLLLGLLNTYLRAKGPNT--LKQSARPVMIVEDPEGRLHP 296 Aliivibrio fis...
Q7MEC9        222 NRNDPRKPRDGLFYNATSADK----NLSQFIQeTNNKQTRLLLMGLLNAYLQAKGPAD--LRRCARPILIIEDPEGRLHP 295 Vibrio vulnifi...
Q9KM45        233 SRKNPRRERDSLLYAASPSEK----SLSQIIHeTKNKQTKLLLLGLLNAYLQGKGPKE--LRRCARPILIIEDPEGRLHP 306 Vibrio cholerae
P75828        226 GQARYRLMRRRASNEQRSWRY--LDIINRMIDrPGGRSYRVILLGLFATLLQAKGTLR--LDKDARPLLLIEDPETRLHP 301 Escherichia co...
WP_011706231  223 IKNKPRSQREIVNRPMTLRNP---GNLQALLRnADNRALQLAMAGMAATLLQARGNRE--LEQGARPIMILEDPESRLHP 297 Aeromonas hydr...
jgi:Asuc_1453 195 SRRNDVLAQKMLLEPTALWDE--LKLLCQRLKqDETRELRTRLVEFLQTLFISDAPVR--TSKYHRPVLLFEDPEARLHP 270 Actinobacillus...
Q9CNG5        200 ---NHKNMTEIKQDTTLLWHK--AKSLCTKLKqDETHRLRKKLFFSLASLFVRNQRIH--FGRFTRPIILFEDPDARLHP 272 Pasteurella mu...
Q65TG6        197 -----QEYAQMSSDPGVLWDL--AQSLCYRLEqRKNPELQQRLVNAITSLFEHNGKLNpgSHRFMRPILLLEDVATRLHP 269 [Mannheimia] s...
Q6D3T4        304 IMLSVAWGLLTQLPLQKVTTTNSGELLSLVPMEQVCRLVRESSRVATYRIGRQGMNAEDSRRIAFHIRLNRPAS 377 Pectobacterium atros...
WP_011768628  307 VNLAITWRFFSLLPMQKLVSTNSSQLLSFLPLSCVQRLVRCTGLTQSYSLNLKHFSQNDLRRVAFHIRMTRPQS 380 Psychromonas ingrahamii
Q6LIW4        301 TVLHQAWTFVDSMPMQKILTTNSPDLLSIVPLGSIKKLIRQPDRTQVFALNKNALSRDEERRISFHVRLHRPSA 374 Photobacterium profu...
Q5E0I1        297 TQLIQAWTLLNHIPMQKILTTNSSELLSAVPLSSIRRLVRESDSTSSYALTPTSLSRDDLRRITFHIRFQRSNA 370 Aliivibrio fischeri ...
Q7MEC9        296 THLARAWSLLQMLPMQKILTTNSGALLGSVPLHSIRRLIRQSDKTVAKSIHPQRFSVDELRRIGFHIRFHRSGA 369 Vibrio vulnificus YJ016
Q9KM45        307 THLARAWSFLDLLPMQKILTTNSSDLLGAVPLHSIRRLVRKSDRTIATSVSQRSLSRDELRRIGFHIRFHRSGA 380 Vibrio cholerae
P75828        302 IMLSVAWHLLNLLPLQRIATTNSGELLSLTPVEHVCRLVRESSRVAAWRLGPSGLSTEDSRRISFHIRFNRPSS 375 Escherichia coli K-12
WP_011706231  298 TMLALAWGLLEQLPGQKLLTTNSGDLLSSLPLNQIRRLVRRQQDIVCHQLGGERYSSDDLRKIAFHVRINRPMS 371 Aeromonas hydrophila
jgi:Asuc_1453 271 RMIAILWELMQYLPIQRITTTNSVELVSQAELKDICRLVRYTDRTLSYQLFRRELGKEDLRRLTFHIHHNRSLA 344 Actinobacillus succi...
Q9CNG5        273 RMVAIMWELVSYLPVQRITTTNSVELLSQVNLNAICRLVRTPEKINCFQLRRKDLGKEDFRRLTFHIHHNRSLA 346 Pasteurella multocida
Q65TG6        270 RMVAIVWKLANYLPIQRITTTNSVELISQVNLRSICRLVRYDDRTRAYQLNRRDLGKEDLRRLSFHVHHNRSRA 343 [Mannheimia] succini...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap