Conserved Protein Domain Family
DUF3172

?
pfam11371: DUF3172 
Protein of unknown function (DUF3172)
This family of proteins has no known function.
Statistics
?
PSSM-Id: 402809
View PSSM: pfam11371
Aligned: 33 rows
Threshold Bit Score: 182.858
Threshold Setting Gi: 427988959
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EKQ69649          45 NATTLAILAGVFILGIGIGMGFSSVSGVSNntgSKIVTQSELDSKAPNADLCVQFGASAIVTDMRVFVTLNPLNFYVSQA 124 Oscillatori...
jgi:Pse7367_0914  28 tgfKLAIAAAIFAIGIAVGVALST---LNPt--QQTVDAIRLDALAPSRDFCNNYGASAMVVSSRVFITLNPYDVYVSRV 102 Pseudanabae...
WP_015167607      22 sgvKLAIAAAIFALGLGLGVALST---LNPt--PQTIDAISLDVNAPSRDFCNNYGASAMVMTSHVYVTLNPFNVYVSQA 96  Synechococc...
CBJ25604         120 atlSKALIAGVFVLGIGTGVTVDSAINTDP---RDLASRDAIDRNAPNPNICQTYGSSAMVVDQRVFVTFNPFSLHVSQA 196 Ectocarpus ...
XP_002181184       1 -svsKALLAGVFVLGVGLGVTIDSQVNTNP---KDLASRDAIDNAAPNPTLCAKLGASAMAFDQRVFVSFNPFNVYVSQA 76  Phaeodactyl...
XP_002505791      37 nkvTNFLVAGAFIVGMGAGVAFDTSVNLEP---TNVASRDILDRQTPSSEVCMANGASAMVFDQRVFLSLNPFNIYVSQP 113 Micromonas ...
jgi:PCC7418_3436  69 NATYWAIIGAVLIIGIGLGMTFSSATNLNT---ENVTSTVAIDRSVPNPEFCAQYGASAVVTDMRVYMSLSPFSVYVTQP 145 Halothece s...
Q31NN3            32 DLMTLSILGGVLIIGIGIGSVITSNLSFSP---ENVVSREALDQQAPDRDICVQYGASAVAMDMRVFMTLNPFSVYVSQP 108 Synechococc...
WP_011934654      45 NTATIAVLAGILIIGIGIGTSLTSNTSGSQ---GNIASSEQLDLAVPDPEFCKQWGASAFVMDVEMYTTMNPSTSFVTQP 121 Synechococc...
WP_011934162      53 NSATIAVLAGVLVIGIGIGSAVTSTTQGDQ---GNIASSQQLDMAVPDPEFCRQWGASAFVMDIEMYTTLNPSSSFVTQP 129 Synechococc...
EKQ69649         125 TSRPGCVLRSNN-WSILE-QRGLVKPEQVRDCKQRMNTFGFTGDLSNNPEINCVYQNNTTQNLF 186 Oscillatoriales cyanobacter...
jgi:Pse7367_0914 103 ESEPGCVVLPNN-WNGLL-RRGAITEQDIRECKNRMNTFGFTGNLGKDTAVDCVYESKNAQEQl 164 Pseudanabaena sp. PCC 7367
WP_015167607      97 KAVPGCVVLPNN-WNLLL-QRNAISDQDIRDCKDRMNTFGYTGDLEKSPRVECVYESKDAKKql 158 Synechococcus sp. PCC 7502
CBJ25604         197 DTKPGCVLRSSNvVEVLQrKRGLLTNEDVETCKGGMNTWGYVGDLNDHPQLSCVYQSDDAQNEF 260 Ectocarpus siliculosus
XP_002181184      77 DVKPACVLREANvVPILK-ARGLINDNEVRSCKQNMNTWAFVGSLDDTPQLSCVYRSQDAQNEF 139 Phaeodactylum tricornutum C...
XP_002505791     114 EVKPGCVLRRSN-WSILE-RNKLVNADQEADCKRNMNTFAFVGDLDKSPEVSCVYHSEEAENQY 175 Micromonas commoda
jgi:PCC7418_3436 146 KMVPGCVMRRTN-WSILE-DQNLVSREQVRDCKNRMNTFAFTGKLEDSPEVNCVYQNDSAGKFF 207 Halothece sp. PCC 7418
Q31NN3           109 VMQPGCVIRRNN-WAVLE-QQGAVSGNDVRDCKNRMNTFAYTGTLRSKPAVNCVYQNDAAQNLF 170 Synechococcus elongatus PCC...
WP_011934654     122 KLQPGCVIRREN-WAVLQ-KAGAVTTDQMRDCKQRMNTFAYIGSIRDKPIVRCVYQTDAGENKF 183 Synechococcus sp. RCC307
WP_011934162     130 TLQPGCVIRREN-WAVLR-KEGAITSAQERECKQRMNTFAYIGSVRDKPVVRCVYQTDISQNKF 191 Synechococcus sp. WH 7803
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap