Conserved Protein Domain Family
SOGA

?
pfam11365: SOGA 
Protein SOGA
The SOGA (suppressor of glucose by autophagy) family consists of proteins SOGA1, SOGA2, and SOGA3. SOGA1 regulates autophagy by playing a role in the reduction of glucose production in an adiponectin and insulin dependent manner.
Statistics
?
PSSM-Id: 402805
View PSSM: pfam11365
Aligned: 27 rows
Threshold Bit Score: 85.794
Threshold Setting Gi: 641662340
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_022534699  552 SASELRRHLQFVEEEAELLRRSISEIEDHNRQLTTELNRFKFGPGPGDGEAEDggtsvvlkpgnggcgdilGVSIPSSgA 631  Mexican tetra
XP_008182209  460 READMREQLRFSEEEAKILRNKVSRLEEDNESMVLQLKKMATKTSYRPTNIADr----------------dEGISDVEdA 523  pea aphid
XP_002588389  499 AQSDVRRQLELVEEETNLMRQSLVEVEKDRDGLQFQLEQYKRKYGEFESSESEqa--------------eqSECSNISkE 564  Florida lancelet
CAG12897      352 ENDDLKCQLAFIKEEAILMRKKMAKIDKEKDRLEQELQKYRSFYGDVDSPLPKg----------------eAGGPPTTrE 415  spotted green...
RMC13016      300 SLSELRQHLQLVEDETELLRRNVADLEEQNKRITAELNKYKYKSGAHESSRHH----------------------DNAkT 357  Hirundo rusti...
CAG01781      300 DLTELRQQLQLVEDEAELLRRNLADAEDQNKRVTGELNKLRFKAGTHEGGARH------------------GGGSDGAkT 361  spotted green...
CAG12897      479 ALSELRQQLQLVEDEAELLRRNLADVEEENKKVTGELNKLKYKAGSHESGSRHa-----------------AGAADTAkV 541  spotted green...
XP_028942992  141 DSADLKCQLHFAKEESALMCKKLTKLAKENDGMKEELLKYRSLYGDLDSSLSVe----------------eLADSPHSrE 204  chuck-will's-...
VCX39824      167 DSADLKCQLQFAKEEGSLMRKKMAKLGREKDALEQELQKYKALYGDVDSPLPTg----------------eAGGPPSTrE 230  wolverine
XP_021329236  574 NVMELQRHLQFVEEEADLLRRSLIEMEEQNKLLMNELNHYKSELPAVTEIEPSsssttit-----sptilpGPSEDAl-N 647  zebrafish
XP_022534699  632 GPLQEELKAARLQIDELSGKVMKLQYENRVL 662  Mexican tetra
XP_008182209  524 TELKLLLELSEQEITVLKRKIEEFEVEKdql 554  pea aphid
XP_002588389  565 AQLKLKLKLVEEEATTLGRKLIEMEVKNEki 595  Florida lancelet
CAG12897      416 SELKLRLRLVEEEANILGRKIVELEVENRGL 446  spotted green pufferfish
RMC13016      358 EALQEELKAARMQINELSGKVMQLQYENRVL 388  Hirundo rustica rustica
CAG01781      362 EALQEELKAARLQINDLSGKVMQLQYENRVL 392  spotted green pufferfish
CAG12897      542 EALQEELKASRLQINELSGKVMQLQYENRVL 572  spotted green pufferfish
XP_028942992  205 AELKVHLKLVEEEANilSRRIVELEVENRGL 235  chuck-will's-widow
VCX39824      231 AELKLRLKLVEEEANILGRKIVELEVENRGL 261  wolverine
XP_021329236  648 EATHKELLAARLQIAELNGKVKKLQYENRVL 678  zebrafish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap