Conserved Protein Domain Family
DUF3164

?
pfam11363: DUF3164 
Protein of unknown function (DUF3164)
This family of proteins has no known function.
Statistics
?
PSSM-Id: 371491
View PSSM: pfam11363
Aligned: 16 rows
Threshold Bit Score: 266.441
Threshold Setting Gi: 501097738
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7NW29                8 YKQDGKGRLVPINIIKPIDIARDEFVAEALQKAVAMQDQLAQFKAGLFADIDAFVALSAERYKADVGGEKGNVTLTSFDG 87  Chromoba...
WP_011797141         12 YWADAEGALIPVSKIKDIDKDRHRTVSDLCEAAKKQRDELISFKTAAMLELSEFINRSLAEYDVKTGGKKGNVTLFSFDG 91  Acidovor...
WP_011526918         20 YMKNTQGHFILKEHIKPIDIERNNFVMQCVNKVKKIQKQLKELKKELTTDLNTFIQQTAKQYKVDMGGVKGNITLMSFDG 99  Lawsonia...
Q8EDT3               12 FRLNALGHAVPESQIKEIDKLRDELVLQIVTAAKEMQGHMATYKATSMRAVADFIDLSASEFGVKFGGTKGNVSLVSFDG 91  Shewanel...
Q8EJ25               14 YRKNAVGDLVHEDRIKPVDKLRDEVVKAIVDNAKLLRQSMTEFKLTTMANINDFVELSSSEYGTKFGGAKGNILLTSFDG 93  Shewanel...
goetting:EBL_c30090  11 YRINAQGHYVPESQVKPLDKLRDDVVLRIIEAAKKQRQAMAEFKLQAMSEVADFIDVSAAEYGVEYGGTKGNVTLVSFDG 90  Shimwell...
WP_012116491         24 YMADAKGALVPLALVKPVDKLTDEAVRKMIHFARDLSAQIGRFRGHCFDDVGSLQALIAQEYGATVGGQKGNISLTTVDG 103 Xanthoba...
Q3IGH8                8 YLKDGKGNLVAVANVKATDLIKDEFVKKAIKCAEDMQAQLAEFKLALMAEADDFIELLAQEHGVNLGGKKGNVTLRTFDS 87  Pseudoal...
Q6D0U9                8 YMTDRKGRLVPISHVSDYDLAMDAFVNDGVASAEIKSADLGDFKKHSFDECYAFMDLVAEKYGRTRGGVKGNVTFSSFDG 87  Pectobac...
Q2NUT0                9 YMKDRKGRLVPVDQVSDYDLAMDSFVKEQVVAAKVKRDELSDFKRRAFDECYAWLDLVAEKYGRTRGGAKGNVTFSSFDG 88  Sodalis ...
Q7NW29               88 NTRVLRAIADTLTFDEGLLAAKALIDECVQEWTEDARPEVKALISDAFQVDKAGNISTGRVLGLRRLDIQDE--KWQRAM 165 Chromoba...
WP_011797141         92 RYKVVRQVQDTLMFDERLMAAKVLIDECIQGWSKGSNANIKVLVNDAFQVDQQGKINKDRVLGLRRLKIEDE--TWRRAM 169 Acidovor...
WP_011526918        100 NYQIKKQMVERISFDEGLQVAKAIIDECIRIWSQSSPGELRAVIEHAFKIDKEGKINTNAILALRRLNIKDP--RWEQAM 177 Lawsonia...
Q8EDT3               92 KYKVQRSIGEHRVFDERIQAAKSKIDDCIKRWSVGSNDHIKALVELSFKVNKQGYIDINQVLSLRQLDIDDT--DWRSAM 169 Shewanel...
Q8EJ25               94 QYQVRRAVGEHRVFDERIQTAKTLIDDCIKSWSGGADTRLMAMVEHAFRVNQQGRIDVNQVLSLRQLDIDDP--KWKQAM 171 Shewanel...
goetting:EBL_c30090  91 RYKLVRAVGEHRVFDERIQAAKTLIDTCISEWSGGADEKIMALVDHAFRVNKQGKIDINQVLGLRQLNIDDI--KWNEAM 168 Shimwell...
WP_012116491        104 TLKVQVQVADLIEFGAELQAAKKLLDACLSEWAEGSRDEIRALVTRAFQVDKEGVVNRAELFMLLRFDSPDE--RWRSAM 181 Xanthoba...
Q3IGH8               88 QLKVTLQTQERIELGPELALAKQLIDQCLDEWTEGGNQNIRAIVSNVFNTDKQGSLNPQRILGLRKLEISDDsgKWTKAM 167 Pseudoal...
Q6D0U9               88 NKQITIKVQESLTFGPELHIAKELIDECVKEWSQGADEKLLALISDAFQVDKEGNLSTTRILSLRRVKIDDE--RWKKAM 165 Pectobac...
Q2NUT0               89 AQQITIRVQETLTFGPELQIAKDLIDECVTEWSEGANANLRAIISDAFQVDKEGQLNTGRILSLRRVKIQDE--RWNRAM 166 Sodalis ...
Q7NW29              166 RALSESVRVQCSKAYVRIERRsEGTGKFEAVRLDLAG 202 Chromobacterium violaceum
WP_011797141        170 DAISDSIKVASSKPYIRFYER-DASDAYRPIVLDVAA 205 Acidovorax citrulli
WP_011526918        178 QAIVDSIHLVETKSYIRIYER-MPDGKLKNISLEMSS 213 Lawsonia intracellularis
Q8EDT3              170 DAIADSIQVMGSTPYLRVYER-QDDGTYKQISLDIAK 205 Shewanella oneidensis
Q8EJ25              172 DAIADAIQITGTSQYLRLYER-QPNGKYTQLPLDISt 207 Shewanella oneidensis
goetting:EBL_c30090 169 DAVADAIQVTGTSQYLRLYER-QADGGYQQISLDLAK 204 Shimwellia blattae DSM 4481 = NBRC 105725
WP_012116491        182 AAIRDSIRVIGSKTYIRFYERaAPDAQWQSISIDLAR 218 Xanthobacter autotrophicus
Q3IGH8              168 NIIAESVGVVDSCRFIRFYKQ-DDKGIEQPISLDIAK 203 Pseudoalteromonas haloplanktis TAC125
Q6D0U9              166 EAISESLLVAVSKTYINFRKK-DESGKLVNIPLDIAA 201 Pectobacterium atrosepticum
Q2NUT0              167 EAISESLQVAMSKTYINFREK-DKHGKLINIPLDIAA 202 Sodalis glossinidius str. 'morsitans'
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap