Conserved Protein Domain Family
DUF3146

?
pfam11344: DUF3146 
Protein of unknown function (DUF3146)
This family of proteins with unknown function appear to be restricted to Cyanobacteria.
Statistics
?
PSSM-Id: 402790
View PSSM: pfam11344
Aligned: 31 rows
Threshold Bit Score: 135.434
Threshold Setting Gi: 81711532
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_023171946         7 PQTEVTMRVSARSLAVGWLEGSVEGGQYQWTFCWHFRAGGrLDIYPSLGRALIKEPLQRFLEKHDFQLETGETYAFTVRA 86  Gloeobact...
jgi:Syn6312_3296    28 PETTAYVRITQHSWTLGQMTGEVLASQYTWHFHWRFKDKA-LDITPALGRALIKEPLSRFLEQKDYQLEPGGDYTFTVRA 106 Synechoco...
WP_015191479         7 PETTAYVRITKQSWHLGNLEGEVKAANYHWQFQWRFRQKK-LLIQPSLGRALIQEPLGRFLEHCDYQLEPGGDYMFTVRT 85  Stanieria...
jgi:PCC8801_1406     7 PETIAYVRITQQSWQQGRIEGEVRAAEYEWQFKWHFRRGR-LLVKPTLGRSLIYEPLGRFLEHCDYQLEPGGDYQFTLRA 85  Rippkaea ...
BAG01776             1 ------MRIIKQSWQTGKLEGEVRTEQYQWRFQWHFLQGK-LSVQPSLGRALIFEPLNRFLERYDYQLEPGGDYEFTVRS 73  Microcyst...
jgi:PCC7424_2617     4 PETIAYVRIIQQSWQEGKIDGEVRAGSYQWRFQWHFRGGT-LSVQPSLGRALIFEPLGRFLERHDYQLEPGSDYQFTLRA 82  Gloeothec...
jgi:Cyast_0448       4 PETIAQVRITNQSWQTGKIQGEIEAGSYQWQFEWQFLQGK-LSLKPTLGRSLIQEPLARFLEHSDYQLEVGGDYQFAVRA 82  Cyanobact...
jgi:Cyan10605_2978   4 PETIVEVKITSQSWSKGEIKGEVNAGSYQWYFKWHFPAGK-LSITPTLGRSLIKEPLCRFLESHDYQLEAGGDYQFCLRA 82  Cyanobact...
P74532              20 PQTKAHLRVTTHSWPGGFLAGEVRAGDYEWQFHWNFRGGK-LRVQPSLGRSLIFEPLGRFLERSDYQLEPGGDYEFTLRS 98  Synechocy...
Q7NPE8               7 PQTEINLRVSARSLSGGWLEGDAEGGQYVWTFRWHFLSGGqLEIHPSLGRALIKEPLQRFLEKNDFRLETGETYAFTVKA 86  Gloeobact...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap