Conserved Protein Domain Family
DUF3136

?
pfam11334: DUF3136 
Protein of unknown function (DUF3136)
This family of proteins with unknown function appear to be restricted to Cyanobacteria.
Statistics
?
PSSM-Id: 402781
View PSSM: pfam11334
Aligned: 5 rows
Threshold Bit Score: 107.957
Threshold Setting Gi: 500468781
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011932599     6 LTIGELEAGYPLYCKALRRLLKEGREVKEIERTVCWGHLETLNRCLPGRYKAPSYLMALIRRDL 69  Synechococcus sp. WH 7803
WP_011932645     8 LTIGDLEAGFSSYCQALRRLVSEGRSMTAIQRTICWDYLQRLHRSLPQSYRSPEDLVLRYQRSH 71  Synechococcus sp. WH 7803
WP_011935615     7 ITIDELEAKYPLYCKALKLLVKEARAIEEIKRSLCWDRLALLHRSLPGRYKSPEHLMDLLQRPQ 70  Synechococcus sp. RCC307
jgi:Cyagr_0991  46 vTIGELEANYSMYCKALRLLVREGRTLKKIQRTVCWHRLEQLHQCLPSQYKDPDYLFLLLRRET 109 Cyanobium gracile PCC 6307
jgi:Cyagr_3421   9 PTIGELEAKYSLYCKAMRLLLKEGRTMEAIQRTVCWSRLEQLHICLPSRYKSPDYLYAVLKRDL 72  Cyanobium gracile PCC 6307
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap