Conserved Protein Domain Family
zinc_ribbon_12

?
pfam11331: zinc_ribbon_12 
Probable zinc-ribbon domain
This eukaryotic family of proteins has no known function.
Statistics
?
PSSM-Id: 402778
View PSSM: pfam11331
Aligned: 37 rows
Threshold Bit Score: 42.5848
Threshold Setting Gi: 1002269844
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_009393087  324 GAAPFVLCSNCFELLRLP-QIILLVSKKICTLCCGSCSEVMSLEL 367  wild Malaysian banana
XP_009380528  450 GAAPFTICSSCFELLQLP-EKSLPLKKNKFKLRCGSCFKLMTIQY 493  wild Malaysian banana
KQK04636      245 GGAPFIVCSSCNQLLQLQpGKCTAGKQN--KVQCGSCSEVVTFTL 287  stiff brome
EMS65263       22 GGAPFVVCSSCNQLLQLPpGKCTSPKQN--RVQCGSCSEVVTFDF 64   Triticum urartu
XP_015629715  446 RGAPFVVCSGCNRLVQLP-TDFAVPSKGTRRLQCGSCSEILSYSY 489  Japanese rice
XP_004969194  228 GAAPFAVCSSCYKLLQMPvEKCIGRKKN--RFQCGSCCQIISLKh 270  foxtail millet
XP_015620636  698 GASPFTICNGCFNLVQVP-SDIYVSKKKIAKFQCGRCSKALMLSF 741  Japanese rice
XP_010658165 1006 GGAPFLTCYHCSHLLQLP-ADFLLFKRRCHGLRCGACYELLKFSV 1049 wine grape
THU53533      454 GAAPFMVCCNCFELLELP-AKLLFSRKKKFNLRCGACSKVILVqr 497  Balbis banana
XP_025881576  235 GAAPFVVCSSCNQLLQLPpGKCTARKQI--QVRCGSCSEIVSFKL 277  Japanese rice
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap