Conserved Protein Domain Family
DUF3132

?
pfam11330: DUF3132 
Protein of unknown function (DUF3132)
This viral family of proteins are 55kDa. No function is currently known.
Statistics
?
PSSM-Id: 371472
View PSSM: pfam11330
Aligned: 2 rows
Threshold Bit Score: 511.973
Threshold Setting Gi: 81939857
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6DN65 234 DITKSSVFKSIGDRVSEEINQKRDDYKKKLIENEKLRRREGKGVKIETETRSSSSSDGETLLEEARKSVSLNISKFLADQ 313 Citrus ringspot virus...
Q6DN65 234 DITKSSVFKSIGDRVSEEINQKRDDYKKKLIENEKLRRREGKGVKIETETRSSSSSDGETLLEEARKSVSLNISKFLADQ 313 Citrus ringspot virus...
Q6DN65 314 RRAPPPPQLEKRTFQWPCGVKMLTMMDTGSSSHYFFSKNITPTSVEMNFGGVAQLEVERAKLSFETFGNKFLLKDVFMFS 393 Citrus ringspot virus...
Q6DN65 314 RRAPPPPQLEKRTFQWPCGVKMLTMMDTGSSSHYFFSKNITPTSVEMNFGGVAQLEVERAKLSFETFGNKFLLKDVFMFS 393 Citrus ringspot virus...
Q6DN65 394 DQSLGDNILSYTLLKEEGHIDGMRTAGDDVLLEKDGEVVMILDSRDEGRMWIKDDVWAEVTEHGSKSAREYCMKVEKNEI 473 Citrus ringspot virus...
Q6DN65 394 DQSLGDNILSYTLLKEEGHIDGMRTAGDDVLLEKDGEVVMILDSRDEGRMWIKDDVWAEVTEHGSKSAREYCMKVEKNEI 473 Citrus ringspot virus...
Q6DN65 474 KV 475 Citrus ringspot virus isolate P-121
Q6DN65 474 KV 475 Citrus ringspot virus isolate P-121
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap