Conserved Protein Domain Family
DUF3112

?
pfam11309: DUF3112 
Protein of unknown function (DUF3112)
This eukaryotic family of proteins has no known function.
Statistics
?
PSSM-Id: 402762
View PSSM: pfam11309
Aligned: 32 rows
Threshold Bit Score: 170.154
Threshold Setting Gi: 74633171
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_013933371 160 PVGGNQRFFQIAMMTIYSIVVAVVIMTIVAGVVPYLYFLSQSHYDMCRNVVKVTSVLICFYSLLAILLVLSAFLIPPSS- 238 Ogataea parapol...
XP_001385406 163 PVGGSRKLFWGVMITLYVVVAGVVAMTIVASIVPYLYFLSERVYTRYKKVVQVTSVLVSLYSLTSISLLGLAYFFKPTK- 241 Scheffersomyces...
CAY71579     166 PYVGSSKLFWGALLTVYSVVISVVVMTIVAAVVPYVYLLSHRNYEMSKNVVKVSSILVILYSLLATGLILVSYLFKPTK- 244 Komagataella ph...
XP_011273260 287 PVYGSSKYFTTLMYIIYSFVIAVVVMTIIAACVRINFFISEHHLHMTQQIFQATSVLILLYSSLSVLLILAAFIIKPSN- 365 Wickerhamomyces...
XP_003009248  68 gaTGWRRKISTIPFFAAIPFLPIMLLTVVNVTILTYFTNDPKVRQDCLTAQKVASVTFVVIAFLPAPFAAAVAILSPPM- 146 Verticillium al...
Q6CF89       165 PETGNSSWFHVVMTVFYCLIIGVVVGAILGQALPYLYFMGPKHYQMCRNVAKAMGIICILWALGGLAMVLAAYIIPVGAv 244 Yarrowia lipoly...
Q6CCE0       194 PETGSASWFNAIMNLIYLLVIGVLVMAIVAQVVPYLYYIDEKHYTMCKKVVRGASVLAMLIAFCGLPIIGLAYMFKPGAl 273 Yarrowia lipoly...
Q6C3Z1       225 PETGDSTWFGTLMIVNYIVIIGIIIMAICSQVTIFIYFLDYEHWRQATGAMQAASVFAVAVASGALINITIAYSLPRGAl 304 Yarrowia lipoly...
Q6C121       220 PETGDATWFGWAMIGVYLVIIGVIVMAVISQVVIFLYFLNYQNWRQATGAMQASSVFATLVAIGGVFLIGLAYVLPRGAl 299 Yarrowia lipoly...
Q6CEL7       261 PETGDATWFGMLMILVYLAIGGVLLLAVVTEVTIFSYFLDYTHWRQATGGMQAASVLIAVISVGGVFIIAIAYALPRGSl 340 Yarrowia lipoly...
XP_013933371 239 ---------RDRK--ATVFQPFWITSFAPTYYAPRGAAEEGQYLFVQRH--------------------GElSKYSERTI 287 Ogataea parapol...
XP_001385406 242 ---------KDED--LYTFQPWWIESFSPLYYVKKGAAQEAAQSFARRH--------------------SI-HRRAIRVI 289 Scheffersomyces...
CAY71579     245 ---------RDKG--CLIYQPTWLESFSPTYFPLKDSAKQHEQIFIGRN--------------------GAaAFASTRII 293 Komagataella ph...
XP_011273260 366 ---------SDKE--ILTYQPHWIKSFNVKYFVPKGSAAQEAKSIPSSK------------------------AHAIRVI 410 Wickerhamomyces...
XP_003009248 147 ---------KKQH-----------------------HQEQAEKEATASS--------------------AArRSFASRVI 174 Verticillium al...
Q6CF89       245 ghefpgfkaKRAKnlRQTTSPFWITSFGIFYY----PEKPKYKTFTKRSleederhgasnnntlfarfvDSeRRNPVRVI 320 Yarrowia lipoly...
Q6CCE0       274 vfl--gnktSKHGgpVTTVSPTWIKSFGTFSYTSPPPRPIYRDQ-------------------------ADgKGHAIRIM 326 Yarrowia lipoly...
Q6C3Z1       305 a-------lHNDD--RRRLTASNIESYGIFWYPPKYSQVLQYEADPSAK--------------------LDsGKLAARVL 355 Yarrowia lipoly...
Q6C121       300 s-------lHNDD--RRRLPASNIESYGMFYFPPKYSQVLQYEADPSAK--------------------IDsGKLAARVL 350 Yarrowia lipoly...
Q6CEL7       341 a-------lSNQD--RSRLPASNIESYGIFYFPPKFSQVLQYKGDPTAK--------------------ISsGKLAARVI 391 Yarrowia lipoly...
XP_013933371 288 LKGGDLYSMADEP---------------------SQLNqfeaqreakYSIKHNNSI--LLVALTSACVFIGAIFRCVLLF 344 Ogataea parapol...
XP_001385406 290 PASHHHYRIVEGL---------------------SKER---------GNINHNASL--LLITVTTVLIFVGCILRAIVVF 337 Scheffersomyces...
CAY71579     294 ASSYHYNAQSDVLpeptaenlklepgnednlvrySSST---------GQLKHNYSI--IIVTLTTTFILIGAVFRAITCF 362 Komagataella ph...
XP_011273260 411 HSTSYHYDTTQDQviqd---------------------------ensKSLTQNTSI--YIIAFSTLLVLIADCFRCASTF 461 Wickerhamomyces...
XP_003009248 175 HPDDRSTGTVRG------------------------------------------SA--LLMAYGSAVLTVGAAYRTTSIL 210 Verticillium al...
Q6CF89       321 -----------------------------------------------SDLNNNPTVcaLLICFTSCVLTTITVCRTVSLF 353 Yarrowia lipoly...
Q6CCE0       327 PVRTAEHPEAPSM---------------------------------------TSNI--MLILASSILLTAGTAMRCASTF 365 Yarrowia lipoly...
Q6C3Z1       356 NGRD--------L---------------------------------------GTST--IIIIITTVLLTVSAALRCATTF 386 Yarrowia lipoly...
Q6C121       351 NGRD--------L---------------------------------------GSSA--AIIIITSLILTTTAAMRCATCF 381 Yarrowia lipoly...
Q6CEL7       392 NGRD--------L---------------------------------------NFSA--SLIVITSVILCATSGMRAATTF 422 Yarrowia lipoly...
XP_013933371 345 FDTT----YATQGWLAKPVVMYMLWGFLEAVVNLLYLFGRVDLRFY 386 Ogataea parapolymorpha DL-1
XP_001385406 338 QGRY----RKDSSILCRPVAMYIVWGVFELFINLCYLIGRVDLRFY 379 Scheffersomyces stipitis CBS 6054
CAY71579     363 LDRT----VETQSWIFKPVVMYMLWGFLETVINVIYLLGRIDLRFY 404 Komagataella phaffii GS115
XP_011273260 462 IEQY----VYEESWIFKPVVMYVMYGALETLINLVYIFGRIDLRFY 503 Wickerhamomyces ciferrii
XP_003009248 211 SPRRm---PGDPAWYHERPAYYCFNYMLELIVVAAYLIFRFDQRFr 253 Verticillium alfalfae VaMs.102
Q6CF89       354 TDEFfkvrQVGNSPVFQNYTLYATFGALECIVNALFLLFRIDLRFY 399 Yarrowia lipolytica
Q6CCE0       366 IEEKa--vPGEMNSIFKPVCLYLAFGLFEALANILYLVARVDLRFY 409 Yarrowia lipolytica
Q6C3Z1       387 IGSRw---EPNEAPIYSGTLFYIGFGVFETITNVIYLVTRIDLRFY 429 Yarrowia lipolytica
Q6C121       382 LGERw---SLNVAPIYSNTLFYIGFGLFETIANVIFLVVRIDLRFY 424 Yarrowia lipolytica
Q6CEL7       423 IGDRw---SHHNKPIFSPTLFYVGFGVFECICNVLYLVARVDLRFY 465 Yarrowia lipolytica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap