Conserved Protein Domain Family
Glyco_hydro_129

?
pfam11308: Glyco_hydro_129 
Glycosyl hydrolases related to GH101 family, GH129
This family of bacterial and lower eukaryote glycosyl hydrolases is related to CAZy family GH129,and distantly to GH101, and is made up of sub-families GHL1-GHL3.
Statistics
?
PSSM-Id: 402761
View PSSM: pfam11308
Aligned: 9 rows
Threshold Bit Score: 410.661
Threshold Setting Gi: 122254520
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6LJF4       389 NLQKVGLKKLWLGLDNWMPAFYQPEVVEQAKKAGYLVGVYDSYNTAIAPGVNDAWLTAQL--PQAMREECAIEKADGNKK 466 Photobacterium ...
Q7NY91       378 ALQAAGLKRLWLGADNWEGGLWQPQAVKAGVDAGYLMTAYDSYETALQLGYREDWLTAQQ--GEAIYRQCGVTLASGKKK 455 Chromobacterium...
WP_012600724 407 NLNKAGLNKLWLGFDNWMPAFYQPNAVELAKQSGYLVGTYDSYNTAIPAKLNDNWLTAQL--PKPMRESCAIEMADGSLK 484 Vibrio tasmanie...
Q9KMR6       375 TLQQAGLSKLWLGLDNWMPAFYQPQVVDSAKQAGYLIGVYDSYNTAIEKGINDSWLTAQL--PDRMRENCAIEKADGTLQ 452 Vibrio cholerae
Q2SB82       404 ALRKAGLTSAWLGANDWLDALWHPQSVKEAKAAGYLVGVYDSYGSIHAPDEPRTWLTAQV--GRENWEKAPYRREDGSIV 481 Hahella chejuen...
WP_011874668 285 RLRELGIDRMWLGYDADGRPM-SPEAVKAAKDAGYLVGPYDSWANAQDPAQADN---PSSrwPAPVWQEACVREADGEVM 360 Saccharopolyspo...
Q81RR8       397 EMKTAGIDNAWIGLPNWEQGYMQPDFVTEAKKMGYLVGPYDSYHSIHEKA-DKNWNTASFt-DPSLYEEATVTKRNGEKV 474 Bacillus anthracis
Q024H3       281 EAKAAGVEKMLIH------GTSSAADMKAINELGYLTSEYDVYQDVM--GVKDESEIASR---AEWVPDNVVLRADGTRM 349 Candidatus Soli...
WP_011704581 364 ALQQAGLRKLWLGTPQWTAALQQGYALTAAQRQGYLVGSYDSYDTAIAPGTNDSWLTAQL--PPEIGKRCAIFEANGEPK 441 Aeromonas hydro...
Q6LJF4       467 KGFR--GNGVYLN--PSCNRDYVENRIKDVIN-YGRFNSIFLDVDATAMAREDYsVSSDGMNQTDMLAAFNARMQWIATD 541 Photobacterium ...
Q7NY91       456 AGFQ--QSGYYTN--PDCVRDTLKQRTRALHA-ATGFNSWFLDAYATGMVFDDY-TPGRQTGKAEMAAGYEKSMQWVADA 529 Chromobacterium...
WP_012600724 485 KGFR--GNGFYLN--PNCHLDYVKQRAADIMR-FGHFNSLFLDVDATAMAREDY-SDN--SSESDMLSAFNNRMQWLSEQ 556 Vibrio tasmanie...
Q9KMR6       453 LGFR--GNGFYLN--PACELGYVKQRVQDILH-FGHFNSLFLDVDGTAMAREDY---RSRSNETAMLAAFNTRMQDIANT 524 Vibrio cholerae
Q2SB82       482 SGFS--SVGAYAN--PLAIKEYAEQRMTAVTR-EARLNSLFLDVDATGMIYEDY-TEGRKTSDAQDVAARTQRLNFPREE 555 Hahella chejuen...
WP_011874668 361 PGFR--DRGCYLSseAFARNPRLMADRTGEMT-ANGANSYFLDVDAAGELHTDH-SPAHPMNKERDRRNRLDRMGRLAGD 436 Saccharopolyspo...
Q81RR8       475 QGFL--GRGRKLN--PTLSLPSVKERMNDILQnGPKYNSWFIDCDATGEIYDDY-SAKHITTQEQDLKARLQRMDYIAQE 549 Bacillus anthracis
Q024H3       350 PAWLtwDKKQYMKrcPTFWLHTAQRVIPKALA-EHPYLGRFIDVTTAENLYECY-DEKHPLDKTEKRQRGEELLGYV-RS 426 Candidatus Soli...
WP_011704581 442 PGFG--GEGVYLN--PGCTLPFAKSRMSELAK-ASGINSLFLDVDGTAMASNDY-NPAHQQGSQAMIADRNARMSWVGER 515 Aeromonas hydro...
Q6LJF4       542 QHVLLGSEDGNALTTQGIAFAHGMETVGF-GWTDPDMKSNRQSPYYLGAWY--PDQKPAFFFQS----AQVKEPYKTLLF 614 Photobacterium ...
Q7NY91       530 YRLPVGSEMGNAATSRGIAFAHGMQAPVM-GWGDADLQKNKQSPYFLGRWY--PSDQPETFFKK----VPLKQPYRDLYF 602 Chromobacterium...
WP_012600724 557 PSLVLGSEDGNSLTTKGIAFAHGLETVGF-GWTDIDMKENRRSPYYLGRWY--PDHKPDFFFKP----ADVKEPYKSPLF 629 Vibrio tasmanie...
Q9KMR6       525 PKLILGSEDGNALTTQGLVFAHGMETVGF-GWTDQAMKSDKQSPYYLGNWY--PDEKPDFFFKS----AQVKEPYRSLLF 597 Vibrio cholerae
Q2SB82       556 LALVTGSEGGSALFANAIEFAHGMTITPF-SWTDPDTGKNRQSTYYRGNYW--PPEAPSLFFAT----KPIKPALRNIYY 628 Hahella chejuen...
WP_011874668 437 --LVLGSESAGAWSAPVLSYNHGSST-----PVSDHLWELEKDKDFWGGYA--PEGAPEAFFEP----VELPADAAKAMF 503 Saccharopolyspo...
Q81RR8       550 KGMVVGSEGGNDFASSTIAFAHGIETPVI-KWDDEDMRKNKTSPYYVGGYWspNQNVPEKYAKQ----VPLKEEYKQVYL 624 Bacillus anthracis
Q024H3       427 LGLVTGGEHGRWWAVPYLDYIEGMMSGGStSWPSGWLKRPKT--------------KDEAFTDPngraFPKWEEYEKWGI 492 Candidatus Soli...
WP_011704581 516 LGLVLGSEDGNALTSKPLLFAHGIQSWGF-GWTDAAMRKQAKSPYYLGKWW--PDEAPQVFFQP----ARLKPRYLKTVF 588 Aeromonas hydro...
Q6LJF4       615 APQYKIPLYQTVFHDELINSHHWHSDSLKF-----NNVQMERDLIAMLYNTPAMVHLS-RDEANTinapRLQALKHYQSG 688 Photobacterium ...
Q7NY91       603 SAPYRLPLYQAAFHGSVITTNHWLYDNLKF-----SNAYADNLLAQWLYNVPPLFHLS-AASLRA----RLPQLQCADRA 672 Chromobacterium...
WP_012600724 630 SPQYRIPLYQAVFHDEVINTHHWHSDSLKF-----TNVQAERDLTAMLYNTPPMVHLT-RDEALSssspRIKALKHYQDG 703 Vibrio tasmanie...
Q9KMR6       598 APEYKVPLYQAVFHDELISSHHWHSDSLKF-----SNVKAVRDLRAMLFNTPAMVHLS-RDETRKns-aRIEQLKHYQQG 670 Vibrio cholerae
Q2SB82       629 NPAYRLPLYQLALHESVVATLHWEYPSLKF-----KETRVDVGLLQLLYMIPPMYHLN-AANLKR----DLPVIAAYDKV 698 Hahella chejuen...
WP_011874668 504 APQYRVPLYQTVLHDSVIGTDRWELPWSKL-----PRQATDRVAMAMLHNTPLNLVLN-ETELDA----HGAEIAALQRY 573 Saccharopolyspo...
Q81RR8       625 NPVYSVPLYKLVYNDAVITTHHWEWGSLKI-----KDEVGNRMLYELLYNVPPLYHLD-EVEWNK----HKQEITKHLKV 694 Bacillus anthracis
Q024H3       493 GHEYRVPLWELVFHDSVISTWYWG-DSSDFlleaaPDVTAKKDAFNILYGTMPMMWANgEGSWVK----NREMFLRTYRN 567 Candidatus Soli...
WP_011704581 589 NPADRLPLYQAVFHDSVLNSHHWLLDNLKF-----PGIKEERALLGLLYNTPPLVNLS-RSTLAS----RLPELVRLDSQ 658 Aeromonas hydro...
Q6LJF4       689 FLPIHKQLWDKALVNFKWLDKQGLLQQTT 717 Photobacterium profundum
Q7NY91       673 FRPLHEQLATQALTGFAWLNAEHTLQQTR 701 Chromobacterium violaceum
WP_012600724 704 FEPMHEQLWDKQLVDFDWLDKSGEVQQTE 732 Vibrio tasmaniensis
Q9KMR6       671 FLPLHEQLWDKALVDFRWLDKQGQVQQTR 699 Vibrio cholerae
Q2SB82       699 FRPWHEKLYRTRMTGFEFLSLDRLLQSTR 727 Hahella chejuensis KCTC 2396
WP_011874668 574 FAPLHQAAATEPMTGFRWLTADHLVQRTT 602 Saccharopolyspora erythraea
Q81RR8       695 WNEFHKKAVKEEMTNFAYLSEDKLVQSAs 723 Bacillus anthracis
Q024H3       568 ACKVHEAVATAEMVSHEFVTADRAVQRTR 596 Candidatus Solibacter usitatus Ellin6076
WP_011704581 659 FGPLHEALWDKALVGFRWRDGVGRVQETR 687 Aeromonas hydrophila
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap