Conserved Protein Domain Family
DUF3088

?
pfam11287: DUF3088 
Protein of unknown function (DUF3088)
This family of proteins with unknown function appears to be restricted to Proteobacteria.
Statistics
?
PSSM-Id: 402742
View PSSM: pfam11287
Aligned: 24 rows
Threshold Bit Score: 131.995
Threshold Setting Gi: 511755944
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5LL51           28 QPILFLLRPDFLDPatgDGAFFCPHCLRLEGLLSIYPVLRHSLQICYVDFPKPRGALAQLAGAESQSCPQLVLPAGDdEL 107 Ruegeria pom...
Q0BX34            3 RDTLFLLPPGFEAN---GQREFCPECAEIWGLIAWYPALKETVDIAYVGIAHPREPLVRLLGPGNHNAPTLVLAAGS-PR 78  Hyphomonas n...
WP_016389267      3 KPQLFLLTPGYGES----ENQFCPDCALVEGFFVYQPALKAMVDFHYIAFTRPRAPLVQLLGEALQNSPALVFPEGIyPE 78  Simiduia aga...
jgi:Caul_4220     2 IDQLYLLEPGFSNGa--LGPLYCGDSVSVEGLLSFFPALREAVDVHYIAFQRPRAPLVEALGEAQQSVPVLILADDTvVK 79  Caulobacter ...
Q63RQ2           43 KDKLFILRPGFYDGa--QGPFYRGDSVAVEGLLSCFAPLRDAVDVEYIDAPRPRHALVALIGEAHQSAPVIVLGAGRtPK 120 Burkholderia...
Q13J72            6 KDKLFMLRPGFYQGt--EGPFYCGDSVAVEGLLGFFPQLRGEVDVEYIDAQRPRIALVGLIGDENQSAPVLILADGKiPL 83  Paraburkhold...
WP_012091234      3 QDRLFLLKPGFEDPaypGQLFYCWHCALIEGVLASFPALGDRLDIERVDWQRPRRAVIELAGEDNQNLPLLVLKDGD--- 79  Ochrobactrum...
HuoZJU:KKY_1803   3 RDKLFLLRPDFEDPaypGQRFYCWHCALLEGVLASFPALAEKLDIERVEWPRPRHPVIAMVGEANQSLPLLVLANGQ--- 79  Pelagibacter...
WP_012462430      2 NPLLFLLKPGFYDGp--GDPYYCPYCMMFEGVLKVYPRLTHQLELRYVDFKKPRQEIIDLIGEENQSCPVIVFDQSY-AS 78  Methylacidip...
CCH48306          2 KDILFLLRGDFTKDt--IGPFYCPDCIALEGILSYFPELREKINVVYVDYDQPRKALVDVLGEENQSCPALVLANPAqAG 79  Pseudodesulf...
Q5LL51          108 SGRWSVAGAADARRIENTADIEDYLILRYGLSD 140 Ruegeria pomeroyi
Q0BX34           79 ATSVTYNEAGGHAFLPSARLIARHFAGLYGTPM 111 Hyphomonas neptunium ATCC 15444
WP_016389267     79 GVPVA---DSGRAYLNDGRAICTWLGNQakgli 108 Simiduia agarivorans
jgi:Caul_4220    80 DAGVEVSSANGRRYIADEKTIRRYLSTQYDQPH 112 Caulobacter sp. K31
Q63RQ2          121 APSIAVREHDGTRFIDSPADIRRYLSSQCGVAH 153 Burkholderia pseudomallei
Q13J72           84 DEGVQTRLYGNTRFIDSPDHIRRYLSSQYGVAR 116 Paraburkholderia xenovorans LB400
WP_012091234     80 RFPFETGRHEGRSLIGDPHKILAVLAERHGFPL 112 Ochrobactrum anthropi
HuoZJU:KKY_1803  80 TSERQSGTFEGRAFINDKDRILVALSERHGFPH 112 Pelagibacterium halotolerans B2
WP_012462430     79 LLPFKANRYGDRLFLNEPEEIGLFLSRVFQIPR 111 Methylacidiphilum infernorum
CCH48306         80 GLGITVKKSQFRSFLDDQKDILHYLHQIHGTSR 112 Pseudodesulfovibrio piezophilus C1TLV30
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap